You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibonucleoside-diphosphate reductase small chain 2
Synonyms
  • Ribonucleotide reductase R2 subunit 2
  • Ribonucleotide reductase small subunit 2
Gene NameRNR4
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionProvides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RNR4 is required for proper folding of RNR2 and assembly with the large subunits
Cellular LocationNucleus.
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
Uridine 5'-diphosphate + a reduced NrdH glutaredoxin-like protein → water + an oxidized NrdH glutaredoxin-like protein + dUDP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00257Guanosine diphosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00746dUDPShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on CH or CH2 groups
oxidoreductase activity, acting on CH or CH2 groups, disulfide as acceptor
ribonucleoside-diphosphate reductase activity
binding
ion binding
catalytic activity
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
Process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside diphosphate metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
deoxyribonucleoside diphosphate metabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 7
LocusYGR180C
Gene Sequence>1038 bp ATGGAAGCACATAACCAATTTTTGAAGACTTTCCAAAAAGAACGTCATGATATGAAAGAA GCTGAAAAGGATGAAATCCTTTTGATGGAAAACAGCCGTAGATTCGTGATGTTCCCTATC AAATACCACGAAATCTGGGCTGCTTACAAGAAGGTTGAAGCCTCTTTCTGGACTGCGGAA GAAATCGAATTGGCTAAGGACACTGAAGATTTCCAAAAATTGACTGATGACCAGAAGACC TACATCGGTAACTTGTTAGCCTTGTCCATTTCTTCTGACAACCTTGTCAACAAGTACTTG ATCGAAAACTTTTCTGCCCAATTGCAAAACCCTGAAGGTAAGAGTTTCTACGGGTTCCAG ATTATGATGGAAAACATCCACTCTGAAGTTTACTCCATGATGGTTGATGCCTTCTTCAAG GACCCTAAGAACATCCCTCTATTCAAGGAAATTGCCAATTTGCCTGAAGTCAAGCATAAG GCTGCTTTCATCGAGAGATGGATTTCCAACGATGACAGCTTGTATGCTGAAAGACTAGTA GCATTTGCTGCAAAGGAAGGTATTTTCCAAGCTGGTAACTATGCTTCTATGTTCTGGTTG ACTGACAAAAAGATTATGCCAGGTTTAGCAATGGCCAACAGAAACATCTGTAGAGACAGA GGTGCCTACACTGACTTTTCATGCTTGCTATTTGCCCATTTGAGAACCAAGCCAAACCCC AAGATCATTGAAAAAATCATTACCGAAGCCGTGGAAATTGAAAAGGAATACTACTCAAAC TCTTTGCCAGTAGAAAAATTTGGTATGGATTTGAAGAGCATTCACACCTACATAGAATTT GTCGCTGACGGTCTATTACAAGGTTTCGGTAACGAAAAATACTACAACGCCGTCAACCCA TTCGAATTCATGGAGGATGTCGCTACCGCTGGTAAGACCACCTTCTTTGAAAAGAAGGTT TCCGACTACCAAAAGGCCAGTGACATGTCTAAGTCCGCTACCCCATCCAAGGAAATTAAC TTTGATGATGACTTCTAA
Protein Properties
Pfam Domain Function
Protein Residues345
Protein Molecular Weight40054.19922
Protein Theoretical pI4.86
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribonucleoside-diphosphate reductase small chain 2 MEAHNQFLKTFQKERHDMKEAEKDEILLMENSRRFVMFPIKYHEIWAAYKKVEASFWTAE EIELAKDTEDFQKLTDDQKTYIGNLLALSISSDNLVNKYLIENFSAQLQNPEGKSFYGFQ IMMENIYSEVYSMMVDAFFKDPKNIPLFKEIANLPEVKHKAAFIERWISNDDSLYAERLV AFAAKEGIFQAGNYASMFWLTDKKIMPGLAMANRNICRDRGAYTDFSCLLFAHLRTKPNP KIIEKIITEAVEIEKEYYSNSLPVEKFGMDLKSIHTYIEFVADGLLQGFGNEKYYNAVNP FEFMEDVATAGKTTFFEKKVSDYQKASDMSKSATPSKEINFDDDF
References
External Links
ResourceLink
Saccharomyces Genome Database RNR4
Uniprot IDP49723
Uniprot NameRIR4_YEAST
GenBank Gene IDAY723819
Genebank Protein ID51830370
PDB ID
1SMS
General Reference
  • Wang, P. J., Chabes, A., Casagrande, R., Tian, X. C., Thelander, L., Huffaker, T. C. (1997). "Rnr4p, a novel ribonucleotide reductase small-subunit protein." Mol Cell Biol 17:6114-6121.9315671
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Nguyen, H. H., Ge, J., Perlstein, D. L., Stubbe, J. (1999). "Purification of ribonucleotide reductase subunits Y1, Y2, Y3, and Y4 from yeast: Y4 plays a key role in diiron cluster assembly." Proc Natl Acad Sci U S A 96:12339-12344.10535923
  • Chabes, A., Domkin, V., Larsson, G., Liu, A., Graslund, A., Wijmenga, S., Thelander, L. (2000). "Yeast ribonucleotide reductase has a heterodimeric iron-radical-containing subunit." Proc Natl Acad Sci U S A 97:2474-2479.10716984
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Yao, R., Zhang, Z., An, X., Bucci, B., Perlstein, D. L., Stubbe, J., Huang, M. (2003). "Subcellular localization of yeast ribonucleotide reductase regulated by the DNA replication and damage checkpoint pathways." Proc Natl Acad Sci U S A 100:6628-6633.12732713
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Lee, Y. D., Wang, J., Stubbe, J., Elledge, S. J. (2008). "Dif1 is a DNA-damage-regulated facilitator of nuclear import for ribonucleotide reductase." Mol Cell 32:70-80.18851834
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Voegtli, W. C., Ge, J., Perlstein, D. L., Stubbe, J., Rosenzweig, A. C. (2001). "Structure of the yeast ribonucleotide reductase Y2Y4 heterodimer." Proc Natl Acad Sci U S A 98:10073-10078.11526233
  • Sommerhalter, M., Voegtli, W. C., Perlstein, D. L., Ge, J., Stubbe, J., Rosenzweig, A. C. (2004). "Structures of the yeast ribonucleotide reductase Rnr2 and Rnr4 homodimers." Biochemistry 43:7736-7742.15196016