You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomoaconitase, mitochondrial
Synonyms
  • Homoaconitate hydratase
Gene NameLYS4
Enzyme Class
Biological Properties
General FunctionInvolved in metabolic process
Specific FunctionResponsible for the dehydration of cis-homoaconitate to homoisocitric acid
Cellular LocationMitochondrion
SMPDB Pathways
lysine metabolismPW002420 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lysine biosynthesisec00300 Map00300
SMPDB Reactions
Citric acidcis-aconitic acid + water
cis-aconitic acid + waterIsocitric acid
cis-homoaconitatewater + (1R,2S)-homoisocitrate
KEGG Reactions
Tetradecanoyl-CoA but-1-ene-1,2,4-tricarboxylic acid + water
but-1-ene-1,2,4-tricarboxylic acid + waterHomoisocitric acid
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00086Citric acidShow
YMDB00096(2R)-Homocitric acidShow
YMDB00144Homoisocitric acidShow
YMDB00269but-1-ene-1,2,4-tricarboxylic acidShow
YMDB00630cis-aconitic acidShow
YMDB00890waterShow
YMDB16304cis-homoaconitateShow
YMDB16305(1R,2S)-homoisocitrateShow
GO Classification
Component
Not Available
Function
hydro-lyase activity
4 iron, 4 sulfur cluster binding
lyase activity
homoaconitate hydratase activity
binding
metal cluster binding
iron-sulfur cluster binding
catalytic activity
carbon-oxygen lyase activity
Process
lysine metabolic process
cellular metabolic process
lysine biosynthetic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
aspartate family amino acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR234W
Gene Sequence>2082 bp ATGCTACGATCAACCACATTTACTCGTTCGTTCCACAGTTCTAGGGCCTGGTTGAAAGGT CAGAACCTAACTGAAAAAATTGTTCAGTCGTATGCGGTCAACCTTCCCGAGGGTAAAGTT GTGCATTCTGGTGACTATGTATCGATCAAGCCGGCACACTGTATGTCCCACGATAATTCG TGGCCTGTAGCTTTGAAATTCATGGGGCTTGGCGCTACCAAGATCAAGAATCCTTCACAG ATTGTGACCACTCTGGACCACGATATTCAGAACAAATCAGAGAAAAATTTGACCAAGTAC AAGAACATCGAAAATTTTGCTAAGAAACACCATATAGACCACTACCCTGCCGGTAGAGGT ATTGGTCATCAAATTATGATTGAGGAGGGCTATGCTTTCCCCTTGAACATGACTGTCGCA TCTGACTCGCATTCAAACACCTACGGTGGTCTGGGGTCGCTGGGCACTCCAATAGTGAGA ACAGACGCTGCAGCCATATGGGCCACGGGACAGACGTGGTGGCAGATCCCACCAGTGGCT CAGGTTGAGTTGAAAGGTCAATTGCCTCAGGGTGTTTCCGGAAAAGATATCATTGTCGCA TTATGTGGGCTTTTCAACAATGATCAAGTTCTAAATCACGCCATTGAATTCACGGGTGAC TCTTTGAATGCATTGCCTATCGATCACAGACTCACTATTGCTAACATGACCACCGAGTGG GGGGCTCTTTCTGGTTTGTTCCCCGTGGACAAAACTTTGATCGACTGGTATAAAAACCGT TTGCAAAAGCTGGGCACCAATAATCATCCAAGGATTAATCCAAAGACTATCCGCGCACTA GAAGAAAAGGCGAAGATTCCGAAAGCAGACAAGGATGCACATTATGCCAAGAAACTGATC ATCGATCTAGCCACGCTAACTCACTACGTCTCAGGTCCAAATAGTGTTAAGGTCTCCAAC ACCGTGCAAGATCTATCTCAACAAGACATCAAGATAAATAAAGCTTATCTAGTGTCATGT ACAAACTCCCGTCTATCTGATTTGCAATCTGCAGCGGATGTGGTTTGTCCTACTGGAGAC TTAAACAAAGTCAACAAGGTGGCTCCAGGTGTGGAGTTCTATGTCGCTGCTGCCTCTTCA GAAATTGAGGCTGATGCCCGTAAATCAGGCGCTTGGGAAAAGCTGCTAAAGGCTGGCTGT ATCCCACTGCCTTCTGGTTGTGGTCCATGCATCGGTCTAGGTGCGGGATTACTGGAACCA GGTGAAGTTGGTATCAGTGCCACAAACAGAAACTTCAAAGGTAGAATGGGTTCCAAGGAT GCATTGGCTTACTTAGCTTCCCCTGCTGTAGTCGCCGCTTCTGCCGTGCTGGGTAAGATT AGTTCTCCTGCTGAGGTATTGTCCACAAGCGAAATTCCATTCAGCGGCGTTAAGACTGAG ATAATTGAGAATCCCGTGGTTGAAGAGGAAGTTAACGCTCAAACAGAGGCTCCAAAACAA TCCGTTGAGATATTAGAAGGTTTCCCAAGAGAGTTTTCTGGTGAATTAGTTTTATGTGAT GCCGATAACATCAATACCGATGGTATATATCCTGGTAAGTACACTTATCAGGATGATGTG CCTAAAGAAAAGATGGCGCAAGTTTGTATGGAAAATTATGATGCCGAGTTCAGAACCAAG GTTCATCCAGGTGATATAGTGGTCAGTGGGTTCAATTTCGGTACCGGTTCCTCCAGGGAA CGAGCGGCCACCGCCTTATTGGCTAAAGGTATCAACTTAGTTGTTTCAGGATCTTTTGGT AATATTTTTTCAAGAAACTCCATTAACAATGCTCTTCTGACCTTGGAAATCCCAGCATTA ATCAAAAAATTACGTGAGAAATATCAAGGTGCTCCAAAAGAACTTACAAGAAGAACTGGT TGGTTTTTGAAATGGGATGTAGCTGATGCTAAAGTGGTCGTTACCGAAGGTTCTTTGGAC GGCCCTGTGATCTTGGAGCAAAAAGTGGGTGAGCTAGGTAAGAACCTACAAGAAATTATT GTAAAAGGAGGCTTGGAAGGTTGGGTCAAATCCCAACTATAA
Protein Properties
Pfam Domain Function
Protein Residues693
Protein Molecular Weight75150.10156
Protein Theoretical pI7.41
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homoaconitase, mitochondrial MLRSTTFTRSFHSSRAWLKGQNLTEKIVQSYAVNLPEGKVVHSGDYVSIKPAHCMSHDNS WPVALKFMGLGATKIKNPSQIVTTLDHDIQNKSEKNLTKYKNIENFAKKHHIDHYPAGRG IGHQIMIEEGYAFPLNMTVASDSHSNTYGGLGSLGTPIVRTDAAAIWATGQTWWQIPPVA QVELKGQLPQGVSGKDIIVALCGLFNNDQVLNHAIEFTGDSLNALPIDHRLTIANMTTEW GALSGLFPVDKTLIDWYKNRLQKLGTNNHPRINPKTIRALEEKAKIPKADKDAHYAKKLI IDLATLTHYVSGPNSVKVSNTVQDLSQQDIKINKAYLVSCTNSRLSDLQSAADVVCPTGD LNKVNKVAPGVEFYVAAASSEIEADARKSGAWEKLLKAGCIPLPSGCGPCIGLGAGLLEP GEVGISATNRNFKGRMGSKDALAYLASPAVVAASAVLGKISSPAEVLSTSEIPFSGVKTE IIENPVVEEEVNAQTEAPKQSVEILEGFPREFSGELVLCDADNINTDGIYPGKYTYQDDV PKEKMAQVCMENYDAEFRTKVHPGDIVVSGFNFGTGSSREQAATALLAKGINLVVSGSFG NIFSRNSINNALLTLEIPALIKKLREKYQGAPKELTRRTGWFLKWDVADAKVVVTEGSLD GPVILEQKVGELGKNLQEIIVKGGLEGWVKSQL
References
External Links
ResourceLink
Saccharomyces Genome Database LYS4
Uniprot IDP49367
Uniprot NameLYS4_YEAST
GenBank Gene IDAY723781
Genebank Protein ID51830249
General Reference
  • Irvin, S. D., Bhattacharjee, J. K. (1998). "A unique fungal lysine biosynthesis enzyme shares a common ancestor with tricarboxylic acid cycle and leucine biosynthetic enzymes found in diverse organisms." J Mol Evol 46:401-408.9541534
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106