You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUbiquinone biosynthesis methyltransferase COQ5, mitochondrial
SynonymsNot Available
Gene NameCOQ5
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionConverts DDMQH2 into DMQH2
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB001742-Hexaprenyl-6-methoxy-1,4-benzoquinoneShow
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB003422-Octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol Show
GO Classification
Component
Not Available
Function
transferase activity, transferring one-carbon groups
methyltransferase activity
catalytic activity
transferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 13
LocusYML110C
Gene Sequence>924 bp ATGTTGATTTCTTCACGGATCGTTCGAAGCTCGCTGGTAAATGTCCCGCTAAGATTATCT AGGTGTTTTACGCAAGCTCACAGAGCATGCAAAGAAGAAGAAGTTAATAGTCCTTTATCA TCCGCAGCTGAACAGCCAGAGCAGAAGTATACGCATTTTGGTTCGAAGACTGTATTGAAG TCTACCAAGCAGAAGTTAGTTGGTGATGTCTTTTCTTCCGTGGCCAATCGGTATGACTTG ATGAATGATGTTATGTCATTAGGAATTCATAGATTGTGGAAGGACCATTTTATCAATAAA CTAGATGCGGGAAAAAGGCCAAACTCTACGACTCCTTTGAACTTCATAGATGTGGCTGGG GGATCCGGTGATATTGCTTTCGGATTACTAGACCATGCTGAGTCGAAATTTGGTGACACT GAGTCTACAATGGATATTGTAGATATCAACCCTGACATGCTTAAAGAAGGTGAGAAGAGA GCCATGGAGCAAGGAAAATATTTCAAGGATCCTCGTGTGAGATTTTTGGTTTCTAATGGT GAGAAACTAGAGGAGATTGATTCTGATTCCAAGGACATCTACACAGTCTCCTTCGGTATC AGAAATTTCACCGATATTCAAAAGGGTTTAAACACTGCTTATAGAGTTTTGAAACCGGGC GGTATTTTTTATTGTCTAGAATTTTCCAAAATTGAGAATCCCCTAATGGACTTTGCTTAC CAACAGTGGGCTAAGGTCCTACCTGTAATGGGCTCGATGATTGCTAATGACTACGACTCT TACCAGTATTTGGTGGAGTCTATCGAAAGATTTCCTGACCAAGAAACGTTCAAATCCATG ATTGAGAAGGCAGGATTCAAATCTGCTGGCTACGAAAGTTTAACTTTTGGTATATGTGCC ATCCATTGGGGCATTAAAGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues307
Protein Molecular Weight34684.19922
Protein Theoretical pI6.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial MLISSRIVRSSLVNVPLRLSRCFTQAHRACKEEEVNSPLSSAAEQPEQKYTHFGSKTVLK STKQKLVGDVFSSVANRYDLMNDVMSLGIHRLWKDHFINKLDAGKRPNSTTPLNFIDVAG GSGDIAFGLLDHAESKFGDTESTMDIVDINPDMLKEGEKRAMEQGKYFKDPRVRFLVSNG EKLEEIDSDSKDIYTVSFGIRNFTDIQKGLNTAYRVLKPGGIFYCLEFSKIENPLMDFAY QQWAKVLPVMGSMIANDYDSYQYLVESIERFPDQETFKSMIEKAGFKSAGYESLTFGICA IHWGIKV
References
External Links
ResourceLink
Saccharomyces Genome Database COQ5
Uniprot IDP49017
Uniprot NameCOQ5_YEAST
GenBank Gene IDAY693194
Genebank Protein ID51013839
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Barkovich, R. J., Shtanko, A., Shepherd, J. A., Lee, P. T., Myles, D. C., Tzagoloff, A., Clarke, C. F. (1997). "Characterization of the COQ5 gene from Saccharomyces cerevisiae. Evidence for a C-methyltransferase in ubiquinone biosynthesis." J Biol Chem 272:9182-9188.9083049
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106