You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHigh-affinity glutamine permease
SynonymsNot Available
Gene NameGNP1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionHigh affinity transport of glutamine. Also transport Leu, Ser, Thr, Cys, Met and Asn
Cellular LocationMitochondrion membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB00046L-CysteineShow
YMDB00112L-SerineShow
YMDB00214L-ThreonineShow
YMDB00226L-AsparagineShow
YMDB00318L-MethionineShow
YMDB00387L-LeucineShow
YMDB00862hydronShow
GO Classification
Component
intrinsic to membrane
integral to membrane
cell part
membrane
membrane part
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
transport
amine transport
amino acid transport
transmembrane transport
establishment of localization
Gene Properties
Chromosome Locationchromosome 4
LocusYDR508C
Gene Sequence>1992 bp ATGACGCTTGGTAATAGACGCCATGGGCGGAATAATGAGGGAAGCTCTAATATGAATATG AATCGTAACGACCTTGACGATGTTTCCCATTACGAGATGAAGGAAATACAACCAAAGGAA AAACAAATTGGCTCTATAGAACCGGAAAATGAAGTAGAATATTTTGAAAAAACAGTGGAA AAAACCATTGAAAATATGGAATATGAAGGTGAACATCATGCATCTTACTTACGGAGGTTC ATTGACTCGTTTAGAAGAGCGGAAGGCTCGCATGCAAATTCCCCAGACTCGAGCAACTCT AATGGGACTACTCCTATATCCACAAAAGATTCCAGCTCTCAATTGGACAATGAGTTGAAT CGGAAGAGCTCATACATCACTGTTGATGGTATTAAACAGTCACCACAAGAACAAGAACAG AAACAAGAAAATTTGAAAAAGAGTATAAAGCCCCGTCATACGGTGATGATGTCCCTAGGG ACTGGTATTGGTACTGGTTTGCTGGTCGGTAACTCCAAAGTTTTGAACAATGCAGGTCCG GGTGGTTTGATCATTGGTTATGCTATTATGGGTAGTTGTGTTTACTGTATTATTCAAGCT TGTGGTGAATTAGCGGTTATATACAGTGATTTGATTGGTGGATTTAATACATATCCTTTG TTTTTGGTCGACCCTGCACTTGGCTTTTCTGTTGCTTGGCTTTTTTGCTTACAATGGCTA TGTGTTTGTCCTCTAGAATTGGTCACTGCATCCATGACTATCAAATATTGGACGACATCT GTGAACCCGGATGTTTTCGTTGTTATCTTCTACGTACTAATCGTTGTTATCAACGTTTTT GGAGCTAAGGGTTATGCAGAGGCAGATTTCTTCTTCAATTGTTGTAAAATTCTGATGATA GTTGGATTTTTCATTCTCGCCATTATTATTGATTGTGGTGGTGCAGGTACCGATAGTTAC ATAGGTAGCAAATATTGGCGTGATCCCGGAGCCTTCCGTGGTGATACACCCATCCAGAGG TTCAAAGGTGTCGTTGCCACATTTGTCACAGCAGCGTTCGCCTTTGGTATGAGTGAACAG CTGGCTATGACTGCCAGTGAACAATCCAATCCAAGAAAGGCTATTCCATCGGCGGCAAAG AAAATGATTTATAGAATTCTGTTTGTGTTCTTGGCGTCTTTAACGTTAGTTGGTTTCCTT GTACCTTACACCTCAGATCAATTGCTAGGGGCCGCAGGTTCAGCCACTAAAGCGTCGCCC TACGTCATCGCTGTCTCCTCTCATGGTGTTCGTGTGGTTCCTCATTTCATAAACGCTGTC ATCCTGTTGTCTGTTCTTTCCGTTGCTAACGGTGCCTTCTATACCAGTTCTCGTATTTTG ATGTCGTTGGCCAAACAAGGTAATGCACCCAAATGTTTCGATTACATCGATAGGGAAGGT AGACCTGCTGCTGCTATGCTTGTCAGTGCATTATTTGGTGTCATTGCATTCTGTGCCTCA TCTAAAAAGGAAGAGGACGTTTTCACCTGGTTGTTAGCAATCTCCGGTTTGTCTCAATTA TTCACGTGGATTACCATTTGTTTGTCTCACATTAGGTTTAGAAGAGCTATGAAAGTGCAA GGAAGGTCCTTAGGAGAGGTTGGTTATAAATCTCAAGTCGGTGTCTGGGGGTCGGCTTAC GCTGTCCTTATGATGGTGTTAGCTTTAATCGCCCAATTTTGGGTTGCCATTGCCCCAATT GGTGGAGGAGGTAAGTTAAGTGCCCAATCATTTTTTGAGAATTATTTGGCTATGCCAATC TGGATTGCTTTATACATCTTTTACAAAGTTTGGAAAAAAGATTGGAGTTTATTCATTCCC GCTGATAAAGTAGACTTAGTTTCTCATAGAAACATCTTTGATGAAGAATTATTAAAACAA GAAGATGAAGAATATAAAGAGAGATTAAGAAACGGACCATACTGGAAAAGAGTTCTTGAT TTCTGGTGTTAA
Protein Properties
Pfam Domain Function
Protein Residues663
Protein Molecular Weight73597.39844
Protein Theoretical pI7.8
Signalling Regions
  • None
Transmembrane Regions
  • 155-175
  • 178-198
  • 220-240
  • 265-285
  • 290-310
  • 343-363
  • 382-402
  • 433-453
  • 482-502
  • 507-527
  • 561-581
  • 591-611
Protein Sequence>High-affinity glutamine permease MTLGNRRHGRNNEGSSNMNMNRNDLDDVSHYEMKEIQPKEKQIGSIEPENEVEYFEKTVE KTIENMEYEGEHHASYLRRFIDSFRRAEGSHANSPDSSNSNGTTPISTKDSSSQLDNELN RKSSYITVDGIKQSPQEQEQKQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGP GGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWL CVCPLELVTASMTIKYWTTSVNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMI VGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDTPIQRFKGVVATFVTAAFAFGMSEQ LAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASP YVIAVSSHGVRVVPHFINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREG RPAAAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQ GRSLGEVGYKSQVGVWGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSAQSFFENYLAMPI WIALYIFYKVWKKDWSLFIPADKVDLVSHRNIFDEELLKQEDEEYKERLRNGPYWKRVLD FWC
References
External Links
ResourceLink
Saccharomyces Genome Database GNP1
Uniprot IDP48813
Uniprot NameGNP1_YEAST
GenBank Gene IDU21643
Genebank Protein ID833812
General Reference
  • Zhu, X., Garrett, J., Schreve, J., Michaeli, T. (1996). "GNP1, the high-affinity glutamine permease of S. cerevisiae." Curr Genet 30:107-114.8660458
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956