You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomocitrate synthase, cytosolic isozyme
SynonymsNot Available
Gene NameLYS20
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Specific FunctionAcetyl-CoA + H(2)O + 2-oxoglutarate = (R)-2- hydroxybutane-1,2,4-tricarboxylate + CoA
Cellular LocationCytoplasm
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
lysine metabolismPW002420 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lysine biosynthesisec00300 Map00300
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Oxoglutaric acid + Acetyl-CoA + water(2R)-Homocitric acid + Coenzyme A + hydron
KEGG Reactions
Oxoglutaric acid + Acetyl-CoA + waterTetradecanoyl-CoA + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00096(2R)-Homocitric acidShow
YMDB00153Oxoglutaric acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Process
metabolic process
cellular metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL182W
Gene Sequence>1287 bp ATGACTGCTGCTAAACCAAATCCATATGCTGCCAAACCGGGCGACTATCTTTCTAATGTA AATAATTTCCAGTTAATCGATTCGACGCTGAGAGAAGGTGAACAATTTGCCAACGCATTC TTCGATACTGAAAAAAAGATCGAAATTGCTAGAGCCTTGGACGATTTCGGTGTGGACTAC ATCGAGTTAACCTCACCAGTAGCATCTGAACAATCAAGAAAGGACTGTGAAGCTATATGT AAACTAGGTTTAAAGGCCAAGATCCTTACACACATTCGTTGTCATATGGATGACGCCAAA GTCGCCGTAGAGACTGGTGTCGACGGTGTCGATGTCGTTATCGGCACCTCCAAATTTTTA AGACAATATTCCCACGGTAAGGATATGAACTACATCGCCAAGAGTGCTGTTGAAGTCATT GAATTTGTCAAATCCAAAGGTATTGAAATCAGATTTTCCTCTGAAGATTCCTTCAGAAGT GATCTCGTTGATCTTTTGAACATTTATAAAACCGTTGACAAGATCGGTGTAAATAGAGTC GGTATTGCCGACACAGTTGGATGTGCCAACCCAAGACAAGTATATGAACTGATCAGAACT TTGAAGAGTGTTGTTTCATGTGACATCGAATGCCATTTCCACAACGATACTGGTTGTGCC ATTGCAAACGCCTACACTGCTTTGGAAGGTGGTGCCAGATTGATTGACGTCAGTGTACTG GGTATTGGTGAAAGAAACGGTATCACTCCTCTAGGTGGGCTCATGGCAAGAATGATTGTT GCCGCACCAGACTATGTCAAGTCCAAATACAAGTTGCACAAGATCAGAGACATTGAAAAC CTGGTCGCTGATGCTGTGGAAGTTAACATTCCATTCAACAACCCTATCACCGGGTTCTGT GCATTCACACATAAAGCAGGTATCCATGCCAAGGCCATTTTGGCTAACCCATCTACCTAC GAAATCTTGGACCCTCACGATTTCGGTATGAAGAGGTATATCCACTTCGCCAACAGACTA ACTGGCTGGAACGCCATCAAAGCCAGAGTCGACCAGTTGAACTTGAACTTGACGGATGAC CAAATCAAGGAAGTTACTGCTAAGATTAAGAAGCTGGGTGATGTCAGATCGCTGAATATC GATGATGTTGACTCTATCATCAAGAACTTCCACGCAGAGGTCAGCACTCCTCAAGTACTA TCTGCAAAAAAGAACAAGAAGAATGACAGCGATGTACCGGAACTGGCCACCATCCCCGCC GCCAAGCGGACTAAGCCATCCGCCTAA
Protein Properties
Pfam Domain Function
Protein Residues428
Protein Molecular Weight47098.39844
Protein Theoretical pI7.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homocitrate synthase, cytosolic isozyme MTAAKPNPYAAKPGDYLSNVNNFQLIDSTLREGEQFANAFFDTEKKIEIARALDDFGVDY IELTSPVASEQSRKDCEAICKLGLKAKILTHIRCHMDDAKVAVETGVDGVDVVIGTSKFL RQYSHGKDMNYIAKSAVEVIEFVKSKGIEIRFSSEDSFRSDLVDLLNIYKTVDKIGVNRV GIADTVGCANPRQVYELIRTLKSVVSCDIECHFHNDTGCAIANAYTALEGGARLIDVSVL GIGERNGITPLGGLMARMIVAAPDYVKSKYKLHKIRDIENLVADAVEVNIPFNNPITGFC AFTHKAGIHAKAILANPSTYEILDPHDFGMKRYIHFANRLTGWNAIKARVDQLNLNLTDD QIKEVTAKIKKLGDVRSLNIDDVDSIIKNFHAEVSTPQVLSAKKNKKNDSDVPELATIPA AKRTKPSA
References
External Links
ResourceLink
Saccharomyces Genome Database LYS20
Uniprot IDP48570
Uniprot NameHOSC_YEAST
GenBank Gene IDX83276
Genebank Protein ID1004312
General Reference
  • Verhasselt, P., Voet, M., Volckaert, G. (1995). "New open reading frames, one of which is similar to the nifV gene of Azotobacter vinelandii, found on a 12.5 kbp fragment of chromosome IV of Saccharomyces cerevisiae." Yeast 11:961-966.8533471
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ramos, F., Verhasselt, P., Feller, A., Peeters, P., Wach, A., Dubois, E., Volckaert, G. (1996). "Identification of a gene encoding a homocitrate synthase isoenzyme of Saccharomyces cerevisiae." Yeast 12:1315-1320.8923736
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956