Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsoleucyl-tRNA synthetase, mitochondrial
Synonyms
  • Isoleucine--tRNA ligase
  • IleRS
Gene NameISM1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-isoleucine + tRNA(Ile) = AMP + diphosphate + L-isoleucyl-tRNA(Ile)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Ile) + L-IsoleucineAdenosine monophosphate + Pyrophosphate + Ile-tRNA(Ile)
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
isoleucine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
ligase activity
Process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
isoleucyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL040C
Gene Sequence>3009 bp ATGAAGCGCTCCAGGCTTGTGCCTCAACATATCTTTAGCATTATTAGCAAGCGATATCTC GCCAAACATGCCTACCAAAAAACATTAAACTTGCCCAAGACCAAATTCCCTAATAGATCA AACTTAGAGATTACATTGAGGGAATTAATACCAAAATCTTCGCAGTTAGTTTACAAGGAG CAGCTACGTGATTTCTTCGAAGAATTTTCAAAGCTTAATACGACTGATGAAAAATTAGAG TTCATTAAAGAAAAGTTGTTCATCTTACATGATGGACCGCCCTATGCCAACGGCGAGCTC CATCTCGGTCATGCTCTAAATAAAATTCTGAAAGATATCATAAACAGATATCAACTTTCA CAGGGGAAGTACATTTTTTATAAGCCTGGCTGGGATTGTCATGGACTACCCATCGAGATT AAAGCTTTGAAAGATTTAAGCGCGCAACAGATCGAGTCAATATCGCCTTTAAAAATCAGG TCAATGGCTTTAAAACATGCACAAAAGGCAATCAAGAGGCAAAGGGAAACTTTCCAACAT TTTGCCATCTTAACGGACTGGGAAACACCATACCTAACAATGGATAAAGACTATGAAATT AATCAGCTAAATATTTTTAAAGAAATGTACGAAAGAGGACTGATTAAGAGACAGAACAAA CCGGTTTACTGGGGTACAGAAACTAGAACAGCGTTAGCAGAGGGCGAATTAGAATATAAT GAAAACCATAAATCCATCGCTGCTTATGTTAAATTTCCTCTTGAAAAGAAATCCCAGATG GATCTGTGCAAAAAACTAGGAATAACGAATAACTTGCCTATATACTGTTTGATTTGGACC AGTACTCCATGGACTCTTCTCTCTAATCGAGCAATCTGTTTCAATCAGGATTTTTCCTAC TCCCTATTACGCTTAAATAGTGAACTTATCCTTGTAGAGACCGGCTCCATTGATAAATTG GGCCTAACAACTAACTCATTTGAGACTATCAAACAGTTTCAAGGAACTCATCTAAATGGG CTATATTATCAAAACCTCTTAGTAGACGATAAGGTTGGCAGGCCCTTATTACATGGTGCA CACGTTACCAGCGGTACAGGGACTGGATTGGTTCATACAGCACCAGGGCATGGACAGGAT GACTATCTCATTGGTATTCAAAATGGTCTTGAAATTTATTCTCCCGTGGATCACCAGGGC CGCTACCAATTAAATGAACTTCCTCAGTCCGTCAGATCCATCGTGAGAGATGAAGGAGAC TTAACAAAAGGTAGGCAAGTATTGGATGCCGAAACCGCGAAAATCATTCCATGTAAGTTA AGCGACCTTAATTTACTTTACAAATCTCACGAATACACGCATTCTTATCCGTACGACTGG AGATCCAAGAAACCTGTCATAATAAGAGCTACTCCACAGTGGTTTGCAGATTTACACGAT GTAAAAAACTTGGCTCTGGAAAGCATCAGCCGCGTCAAGTTTTGTCCTAAAAGAGGCTAT TCAAGACTTTCATCCTTTATGAAAAGCAGAAATGAATGGTGCATATCTAGGCAACGCTCA TGGGGTATCCCTATATTAAGCTTTTACAAGAAGAGCGAACCGGATTCTGTTTTGATGAAT TCAGAAATTTTGGCACATGCCATAGAAAAAATCAAACAAAAAGGAATTAATGCATGGTTT AACGATAAAGATAATGACATGAAAGAATGGTTGCCAGAAAAATATCACGACGTAGCGCAT GAATACTGTCGTTCTCAAGATACTATGGATGTGTGGTTTGATAGTGGGTCGTCATGGAGT GTGATCAAAGACTTTTATGAAAAAAGCTTAAAGTTGTCAAAACTCCCATCCCCCCTGTAC CAAGTTTGTCTAGAAGGATCTGATCAACATAGAGGATGGTTTCAAAGTTCACTGCTAACA AAAGTAGCATCAAGTAATGTCCCTGTTGCACCATATGAAGAAGTGATTACTCATGGTTTT ACCCTAGATGAGAATGGTCTGAAAATGTCAAAACTTGTGGGAAATACAATTTCTCCCGAA GCAATAATTCGAGGCGATGAAAACTTAGGCTTACCAGCTTTGGGTGTTGATGGCTTGAGG TATCTGATAGCACAATCGAATTTCACAACTGATATAGTTGCTGGCCCGACTGTGATGAAA CATGTAGGAGAAGCTCTAAAAAAGGTTAGACTAACTTTTCGCTATTTATTGAGTAATTTA CAGAAGTCCCAAGATTTCAACCTTTTGCCGATTGAACAATTACGCCGTGTTGATCAATAT ACCTTGTATAAGATAAACGAACTGCTGGAAACGACGAGAGAACACTACCAAAAGTACAAC TTTTCCAAGGTTCTCATTACTCTACAATATCATTTAAATAACGAGCTATCGGCGTTTTAT TTTGATATCTCAAAAGGTATTTTATATTCCAACCAAATATCGTCATTGGCAAGAAGGCAG GTCCAAACAACGCTTGTCCATATACTAAATGCATATAGGGCAATTCTTGCACCAATATTA CCCGTTATGGTCCAAGAAGTATGGAAGTATATACCAGAAGGATGGTTACAAGGACAAGAA CATATAGACATTAATCCGATGCGTGGAAAATGGCCGTTTTTGGACTCAAATACGGAAATC GTCACCTCCTTTGAAAACTTTGAACTAAAAATTCTAAAACAGTTCCAGGAGGAATTCAAG AGGTTAAGTCTAGAAGAAGGTGTCACCAAAACAACACATAGTCACGTTACCATTTTCACC AAGCATCACCTCCCATTCAGTTCTGACGAGCTTTGCGACATATTGCAATCATCTGCTGTT GATATATTGCAAATGGACGATAATAATAACAGTCTACCAACTATTGAATTGGGAAGCGGA ATAAACGTTCAAATATTGGTTGAACGAAGCAAAAGGCACAACTGTCCCAGATGTTGGAAG GCCAACTCAGCCGAAGAGGATAAATTGTGTGACAGATGTAAAGAAGCTGTGGATCATCTC ATGTCTTGA
Protein Properties
Pfam Domain Function
Protein Residues1002
Protein Molecular Weight115793.0
Protein Theoretical pI8.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isoleucyl-tRNA synthetase, mitochondrial MKRSRLVPQHIFSIISKRYLAKHAYQKTLNLPKTKFPNRSNLEITLRELIPKSSQLVYKE QLRDFFEEFSKLNTTDEKLEFIKEKLFILHDGPPYANGELHLGHALNKILKDIINRYQLS QGKYIFYKPGWDCHGLPIEIKALKDLSAQQIESISPLKIRSMALKHAQKAIKRQRETFQH FAILTDWETPYLTMDKDYEINQLNIFKEMYERGLIKRQNKPVYWGTETRTALAEGELEYN ENHKSIAAYVKFPLEKKSQMDLCKKLGITNNLPIYCLIWTSTPWTLLSNRAICFNQDFSY SLLRLNSELILVETGSIDKLGLTTNSFETIKQFQGTHLNGLYYQNLLVDDKVGRPLLHGA HVTSGTGTGLVHTAPGHGQDDYLIGIQNGLEIYSPVDHQGRYQLNELPQSVRSIVRDEGD LTKGRQVLDAETAKIILCKLSDLNLLYKSHEYTHSYPYDWRSKKPVIIRATPQWFADLHD VKNLALESISRVKFCPKRGYSRLSSFMKSRNEWCISRQRSWGIPILSFYKKSEPDSVLMN SEILAHAIEKIKQKGINAWFNDKDNDMKEWLPEKYHDVAHEYCRSQDTMDVWFDSGSSWS VIKDFYEKSLKLSKLPSPLYQVCLEGSDQHRGWFQSSLLTKVASSNVPVAPYEEVITHGF TLDENGLKMSKSVGNTISPEAIIRGDENLGLPALGVDGLRYLIAQSNFTTDIVAGPTVMK HVGEALKKVRLTFRYLLSNLQKSQDFNLLPIEQLRRVDQYTLYKINELLETTREHYQKYN FSKVLITLQYHLNNELSAFYFDISKDILYSNQISSLARRQVQTTLVHILNAYRAILAPIL PVMVQEVWKYIPEGWLQGQEHIDINPMRGKWPFLDSNTEIVTSFENFELKILKQFQEEFK RLSLEEGVTKTTHSHVTIFTKHHLPFSSDELCDILQSSAVDILQMDDNNNSLPTIELGSG INVQILVERSKRHNCPRCWKANSAEEDKLCDRCKEAVDHLMS
References
External Links
ResourceLink
Saccharomyces Genome Database ISM1
Uniprot IDP48526
Uniprot NameSYIM_YEAST
GenBank Gene IDL38957
Genebank Protein ID625184
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106