You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsoleucyl-tRNA synthetase, mitochondrial
Synonyms
  • Isoleucine--tRNA ligase
  • IleRS
Gene NameISM1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-isoleucine + tRNA(Ile) = AMP + diphosphate + L-isoleucyl-tRNA(Ile)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Ile) + L-IsoleucineAdenosine monophosphate + Pyrophosphate + Ile-tRNA(Ile)
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
isoleucine-tRNA ligase activity
binding
nucleotide binding
Process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
isoleucyl-tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 16
LocusYPL040C
Gene Sequence>3009 bp ATGAAGCGCTCCAGGCTTGTGCCTCAACATATCTTTAGCATTATTAGCAAGCGATATCTC GCCAAACATGCCTACCAAAAAACATTAAACTTGCCCAAGACCAAATTCCCTAATAGATCA AACTTAGAGATTACATTGAGGGAATTAATACCAAAATCTTCGCAGTTAGTTTACAAGGAG CAGCTACGTGATTTCTTCGAAGAATTTTCAAAGCTTAATACGACTGATGAAAAATTAGAG TTCATTAAAGAAAAGTTGTTCATCTTACATGATGGACCGCCCTATGCCAACGGCGAGCTC CATCTCGGTCATGCTCTAAATAAAATTCTGAAAGATATCATAAACAGATATCAACTTTCA CAGGGGAAGTACATTTTTTATAAGCCTGGCTGGGATTGTCATGGACTACCCATCGAGATT AAAGCTTTGAAAGATTTAAGCGCGCAACAGATCGAGTCAATATCGCCTTTAAAAATCAGG TCAATGGCTTTAAAACATGCACAAAAGGCAATCAAGAGGCAAAGGGAAACTTTCCAACAT TTTGCCATCTTAACGGACTGGGAAACACCATACCTAACAATGGATAAAGACTATGAAATT AATCAGCTAAATATTTTTAAAGAAATGTACGAAAGAGGACTGATTAAGAGACAGAACAAA CCGGTTTACTGGGGTACAGAAACTAGAACAGCGTTAGCAGAGGGCGAATTAGAATATAAT GAAAACCATAAATCCATCGCTGCTTATGTTAAATTTCCTCTTGAAAAGAAATCCCAGATG GATCTGTGCAAAAAACTAGGAATAACGAATAACTTGCCTATATACTGTTTGATTTGGACC AGTACTCCATGGACTCTTCTCTCTAATCGAGCAATCTGTTTCAATCAGGATTTTTCCTAC TCCCTATTACGCTTAAATAGTGAACTTATCCTTGTAGAGACCGGCTCCATTGATAAATTG GGCCTAACAACTAACTCATTTGAGACTATCAAACAGTTTCAAGGAACTCATCTAAATGGG CTATATTATCAAAACCTCTTAGTAGACGATAAGGTTGGCAGGCCCTTATTACATGGTGCA CACGTTACCAGCGGTACAGGGACTGGATTGGTTCATACAGCACCAGGGCATGGACAGGAT GACTATCTCATTGGTATTCAAAATGGTCTTGAAATTTATTCTCCCGTGGATCACCAGGGC CGCTACCAATTAAATGAACTTCCTCAGTCCGTCAGATCCATCGTGAGAGATGAAGGAGAC TTAACAAAAGGTAGGCAAGTATTGGATGCCGAAACCGCGAAAATCATTCCATGTAAGTTA AGCGACCTTAATTTACTTTACAAATCTCACGAATACACGCATTCTTATCCGTACGACTGG AGATCCAAGAAACCTGTCATAATAAGAGCTACTCCACAGTGGTTTGCAGATTTACACGAT GTAAAAAACTTGGCTCTGGAAAGCATCAGCCGCGTCAAGTTTTGTCCTAAAAGAGGCTAT TCAAGACTTTCATCCTTTATGAAAAGCAGAAATGAATGGTGCATATCTAGGCAACGCTCA TGGGGTATCCCTATATTAAGCTTTTACAAGAAGAGCGAACCGGATTCTGTTTTGATGAAT TCAGAAATTTTGGCACATGCCATAGAAAAAATCAAACAAAAAGGAATTAATGCATGGTTT AACGATAAAGATAATGACATGAAAGAATGGTTGCCAGAAAAATATCACGACGTAGCGCAT GAATACTGTCGTTCTCAAGATACTATGGATGTGTGGTTTGATAGTGGGTCGTCATGGAGT GTGATCAAAGACTTTTATGAAAAAAGCTTAAAGTTGTCAAAACTCCCATCCCCCCTGTAC CAAGTTTGTCTAGAAGGATCTGATCAACATAGAGGATGGTTTCAAAGTTCACTGCTAACA AAAGTAGCATCAAGTAATGTCCCTGTTGCACCATATGAAGAAGTGATTACTCATGGTTTT ACCCTAGATGAGAATGGTCTGAAAATGTCAAAACTTGTGGGAAATACAATTTCTCCCGAA GCAATAATTCGAGGCGATGAAAACTTAGGCTTACCAGCTTTGGGTGTTGATGGCTTGAGG TATCTGATAGCACAATCGAATTTCACAACTGATATAGTTGCTGGCCCGACTGTGATGAAA CATGTAGGAGAAGCTCTAAAAAAGGTTAGACTAACTTTTCGCTATTTATTGAGTAATTTA CAGAAGTCCCAAGATTTCAACCTTTTGCCGATTGAACAATTACGCCGTGTTGATCAATAT ACCTTGTATAAGATAAACGAACTGCTGGAAACGACGAGAGAACACTACCAAAAGTACAAC TTTTCCAAGGTTCTCATTACTCTACAATATCATTTAAATAACGAGCTATCGGCGTTTTAT TTTGATATCTCAAAAGGTATTTTATATTCCAACCAAATATCGTCATTGGCAAGAAGGCAG GTCCAAACAACGCTTGTCCATATACTAAATGCATATAGGGCAATTCTTGCACCAATATTA CCCGTTATGGTCCAAGAAGTATGGAAGTATATACCAGAAGGATGGTTACAAGGACAAGAA CATATAGACATTAATCCGATGCGTGGAAAATGGCCGTTTTTGGACTCAAATACGGAAATC GTCACCTCCTTTGAAAACTTTGAACTAAAAATTCTAAAACAGTTCCAGGAGGAATTCAAG AGGTTAAGTCTAGAAGAAGGTGTCACCAAAACAACACATAGTCACGTTACCATTTTCACC AAGCATCACCTCCCATTCAGTTCTGACGAGCTTTGCGACATATTGCAATCATCTGCTGTT GATATATTGCAAATGGACGATAATAATAACAGTCTACCAACTATTGAATTGGGAAGCGGA ATAAACGTTCAAATATTGGTTGAACGAAGCAAAAGGCACAACTGTCCCAGATGTTGGAAG GCCAACTCAGCCGAAGAGGATAAATTGTGTGACAGATGTAAAGAAGCTGTGGATCATCTC ATGTCTTGA
Protein Properties
Pfam Domain Function
Protein Residues1002
Protein Molecular Weight115793.0
Protein Theoretical pI8.29
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isoleucyl-tRNA synthetase, mitochondrial MKRSRLVPQHIFSIISKRYLAKHAYQKTLNLPKTKFPNRSNLEITLRELIPKSSQLVYKE QLRDFFEEFSKLNTTDEKLEFIKEKLFILHDGPPYANGELHLGHALNKILKDIINRYQLS QGKYIFYKPGWDCHGLPIEIKALKDLSAQQIESISPLKIRSMALKHAQKAIKRQRETFQH FAILTDWETPYLTMDKDYEINQLNIFKEMYERGLIKRQNKPVYWGTETRTALAEGELEYN ENHKSIAAYVKFPLEKKSQMDLCKKLGITNNLPIYCLIWTSTPWTLLSNRAICFNQDFSY SLLRLNSELILVETGSIDKLGLTTNSFETIKQFQGTHLNGLYYQNLLVDDKVGRPLLHGA HVTSGTGTGLVHTAPGHGQDDYLIGIQNGLEIYSPVDHQGRYQLNELPQSVRSIVRDEGD LTKGRQVLDAETAKIILCKLSDLNLLYKSHEYTHSYPYDWRSKKPVIIRATPQWFADLHD VKNLALESISRVKFCPKRGYSRLSSFMKSRNEWCISRQRSWGIPILSFYKKSEPDSVLMN SEILAHAIEKIKQKGINAWFNDKDNDMKEWLPEKYHDVAHEYCRSQDTMDVWFDSGSSWS VIKDFYEKSLKLSKLPSPLYQVCLEGSDQHRGWFQSSLLTKVASSNVPVAPYEEVITHGF TLDENGLKMSKSVGNTISPEAIIRGDENLGLPALGVDGLRYLIAQSNFTTDIVAGPTVMK HVGEALKKVRLTFRYLLSNLQKSQDFNLLPIEQLRRVDQYTLYKINELLETTREHYQKYN FSKVLITLQYHLNNELSAFYFDISKDILYSNQISSLARRQVQTTLVHILNAYRAILAPIL PVMVQEVWKYIPEGWLQGQEHIDINPMRGKWPFLDSNTEIVTSFENFELKILKQFQEEFK RLSLEEGVTKTTHSHVTIFTKHHLPFSSDELCDILQSSAVDILQMDDNNNSLPTIELGSG INVQILVERSKRHNCPRCWKANSAEEDKLCDRCKEAVDHLMS
References
External Links
ResourceLink
Saccharomyces Genome Database ISM1
Uniprot IDP48526
Uniprot NameSYIM_YEAST
GenBank Gene IDL38957
Genebank Protein ID625184
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106