Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBiotin--protein ligase
Synonyms
  • Biotin apo-protein ligase
  • Biotin--[methylmalonyl-CoA-carboxytransferase] ligase
  • Biotin--[propionyl-CoA-carboxylase [ATP-hydrolyzing]] ligase
  • Holocarboxylase synthetase
  • HCS
  • Biotin--[methylcrotonoyl-CoA-carboxylase] ligase
  • Biotin--[acetyl-CoA-carboxylase] ligase
Gene NameBPL1
Enzyme Class
Biological Properties
General FunctionInvolved in biotin-[acetyl-CoA-carboxylase] ligase activity
Specific FunctionPost-translational modification of specific protein by attachment of biotin. Acts on various carboxylases such as acetyl- CoA-carboxylase, pyruvate carboxylase, propionyl CoA carboxylase, and 3-methylcrotonyl CoA carboxylase
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Biotin metabolismec00780 Map00780
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + Biotin + hydronPyrophosphate + Biotinyl-5'-AMP
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00282BiotinShow
YMDB00602Biotinyl-5'-AMPShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
ligase activity
ligase activity, forming carbon-nitrogen bonds
biotin-protein ligase activity
biotin-[acetyl-CoA-carboxylase] ligase activity
catalytic activity
Process
macromolecule metabolic process
macromolecule modification
protein modification process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL141W
Gene Sequence>2073 bp ATGAATGTATTAGTCTATAATGGCCCAGGGACTACGCCAGGATCAGTTAAGCATGCTGTT GAAAGTTTACGTGACTTTTTGGAACCCTATTACGCCGTCAGTACTGTCAATGTTAAGGTA TTACAGACAGAACCATGGATGTCAAAGACCTCCGCTGTAGTTTTTCCTGGTGGTGCCGAT CTTCCTTACGTTCAAGCTTGTCAACCCATTATTTCTCGATTGAAACATTTTGTTAGCAAA CAAGGTGGTGTCTTTATCGGATTTTGTGCAGGAGGTTACTTTGGCACCAGCCGTGTAGAA TTTGCTCAAGGTGACCCTACAATGGAAGTATCAGGAAGCAGGGATTTGCGATTCTTTCCG GGAACAAGCAGAGGACCTGCGTACAATGGATTTCAGTATAACAGCGAGGCCGGTGCACGT GCAGTTAAATTGAATCTTCCAGATGGCTCACAGTTCTCAACTTATTTCAATGGAGGAGCC GTTTTTGTTGATGCAGATAAATTTGATAATGTCGAGATCTTGGCCACGTACGCAGAACAC CCGGATGTGCCTTCTTCTGACTCAGGAAAAGGTCAAAGTGAAAACCCAGCTGCTGTAGTG CTATGTACGGTCGGAAGAGGAAAGGTTTTACTCACTGGACCACACCCTGAATTCAACGTC CGTTTTATGAGGAAATCCACAGATAAGCATTTTCTTGAAACCGTTGTGGAAAACCTGAAA GCACAGGAAATCATGAGGTTGAAATTTATGAGAACGGTTCTTACCAAAACTGGGTTGAAT TGTAATAATGACTTCAATTATGTAAGAGCTCCAAATTTGACACCACTGTTTATGGCTAGT GCACCTAATAAGCGGAATTACTTGCAAGAAATGGAAAACAACTTAGCTCATCATGGAATG CATGCAAATAATGTTGAACTCTGCTCAGAATTAAACGCCGAAACTGACTCTTTCCAATTT TATAGAGGCTATAGAGCCTCTTACGATGCAGCAAGTTCGTCCTTGCTTCATAAAGAGCCA GATGAGGTTCCTAAGACCGTAATATTTCCTGGCGTAGATGAAGATATTCCACCATTTCAA TATACGCCCAATTTTGACATGAAAGAATACTTCAAGTATCTGAATGTTCAAAACACCATA GGTTCTTTACTTCTATATGGTGAAGTTGTTACATCAACGAGTACCATATTGAATAATAAT AAATCCTTATTAAGTTCGATCCCTGAAAGCACTTTACTTCACGTGGGTACTATTCAGGTT TCTGGGCGTGGGAGAGGTGGTAACACTTGGATTAATCCTAAAGGTGTTTGCGCATCAACG GCCGTCGTAACAATGCCGCTTCAATCGCCTGTGACTAATCGAAATATATCAGTTGTTTTT GTCCAGTATCTTTCTATGCTTGCTTACTGTAAGGCGATACTTTCGTACGCTCCTGGATTT TCAGATATTCCTGTTAGGATCAAATGGCCCAATGACCTTTATGCTTTGAGCCCCACCTAC TATAAGCGTAAAAACTTGAAATTGGTTAACACCGGTTTTGAGCATACAAAGTTGCCCTTA GGTGATATCGAGCCCGCTTATCTTAAGATCTCTGGTTTATTAGTTAATACCCACTTCATA AACAATAAATATTGTTTGCTACTTGGCTGTGGTATAAATTTGACTAGTGATGGTCCTACA ACTTCATTACAAACTTGGATTGATATCCTGAATGAAGAACGCCAACAATTACACCTTGAT TTATTGCCAGCAATAAAGGCAGAAAAGCTGCAGGCACTCTATATGAATAACCTTGAGGTC ATATTAAAACAGTTTATTAACTACGGAGCTGCGGAAATATTGCCAAGTTATTATGAGTTG TGGTTACATAGTAACCAAATAGTAACATTACCAGATCACGGAAATACGCAAGCCATGATT ACTGGTATCACGGAAGACTACGGTTTACTGATTGCAAAAGAATTGGTAAGCGGTAGTTCC ACTCAATTTACAGGAAACGTTTATAATTTACAGCCGGACGGTAACACTTTTGATATCTTC AAGAGCTTAATTGCTAAAAAGGTTCAGAGTTAA
Protein Properties
Pfam Domain Function
Protein Residues690
Protein Molecular Weight76362.39844
Protein Theoretical pI6.91
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Biotin--protein ligase MNVLVYNGPGTTPGSVKHAVESLRDFLEPYYAVSTVNVKVLQTEPWMSKTSAVVFPGGAD LPYVQACQPIISRLKHFVSKQGGVFIGFCAGGYFGTSRVEFAQGDPTMEVSGSRDLRFFP GTSRGPAYNGFQYNSEAGARAVKLNLPDGSQFSTYFNGGAVFVDADKFDNVEILATYAEH PDVPSSDSGKGQSENPAAVVLCTVGRGKVLLTGPHPEFNVRFMRKSTDKHFLETVVENLK AQEIMRLKFMRTVLTKTGLNCNNDFNYVRAPNLTPLFMASAPNKRNYLQEMENNLAHHGM HANNVELCSELNAETDSFQFYRGYRASYDAASSSLLHKEPDEVPKTVIFPGVDEDIPPFQ YTPNFDMKEYFKYLNVQNTIGSLLLYGEVVTSTSTILNNNKSLLSSIPESTLLHVGTIQV SGRGRGGNTWINPKGVCASTAVVTMPLQSPVTNRNISVVFVQYLSMLAYCKAILSYAPGF SDIPVRIKWPNDLYALSPTYYKRKNLKLVNTGFEHTKLPLGDIEPAYLKISGLLVNTHFI NNKYCLLLGCGINLTSDGPTTSLQTWIDILNEERQQLHLDLLPAIKAEKLQALYMNNLEV ILKQFINYGAAEILPSYYELWLHSNQIVTLPDHGNTQAMITGITEDYGLLIAKELVSGSS TQFTGNVYNLQPDGNTFDIFKSLIAKKVQS
References
External Links
ResourceLink
Saccharomyces Genome Database BPL1
Uniprot IDP48445
Uniprot NameBPL1_YEAST
GenBank Gene IDU27182
Genebank Protein ID886081
General Reference
  • Cronan, J. E. Jr, Wallace, J. C. (1995). "The gene encoding the biotin-apoprotein ligase of Saccharomyces cerevisiae." FEMS Microbiol Lett 130:221-229.7649444
  • Wolfl, S., Hanemann, V., Saluz, H. P. (1996). "Analysis of a 26,756 bp segment from the left arm of yeast chromosome IV." Yeast 12:1549-1554.8972577
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106