You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameVacuolar acid trehalase
Synonyms
  • Alpha,alpha-trehalase
  • Alpha,alpha-trehalose glucohydrolase
Gene NameATH1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionAlpha,alpha-trehalose + H(2)O = 2 D-glucose
Cellular LocationVacuole.
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Trehalose + waterD-Glucose
KEGG Reactions
water + TrehaloseD-Glucose
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00286D-GlucoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
carbohydrate binding
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR026W
Gene Sequence>3636 bp ATGAAAAGAATAAGATCGCTTTGGTTCAATGCGGAGGCTTCTTATTCAAACCTTAACAAT TCTCCTAGTTTGAGGAACAAAAATAGTACCGGTAATAACTCTCGCTCTAAAAATTATCGT TCTTTCTCAAGGTTTGACTTGATCAACTCTATACTTTTACTGATGATGCTATTTTTATTA GCTATCTTCGTCACTGCATTATATTTAACAAAGAGTTCCAGGCTTACATACTCACATGCC TCGAGGGCTGCCCTATTTAACCCTCTGGGTGTGATATCGCCGTCATTGGGAAATCATACG TTGAACTACGATCCAGAAGCAAGGGAATCTTCTAAAAAACTTTATGAACTCCTTTCTGAT TTCAACACGGCATATTATGATGATGAGAACATGATTTTGGGAAGTAACTTGTTCTCAAAG AATACATACTCGAGACAACCATATGTTGCTAACGGTTATATAGGTAGTCGTATTCCCAAT ATTGGGTTCGGCTATGCCTTAGACACCCTGAATTTTTACACAGACGCACCAGGCGCTTTG AATAACGGTTGGCCCTTAAGAAATCATAGATTTGCCGGTGCGTTTGTATCGGACTTTTAT TGTCTACAACCAAAACTAAATTCAACAAACTTCCCAGAATTGGATGATGTAGGATATTCC ACTGTCATTTCATCTATTCCACAATGGACCAATCTACAGTTCTCATTAGTGAATGATTCT AAGTGGTTCAATCCACAAAATGTTACGTTGGATGACGTAACTAATTATAGCCAAAACTTA TCAATGAAGGATGGTATCGTAACTACGGAGTTAGATTGGCTAAACAGTCAAATACATGTT AAAAGTGAAATCTGGGCACATCGGCACATTCATCCACTGGGAGTGGTTTCTTTGGAAATT TCCCTGAATACGGACCATTTACCTTCGGATTTTGATTCATTAGATGTTAATATATGGGAT ATACTTGATTTCAACACATCACATAGGACTGTTCTACATAGCACGGGAACAGACGAAAAA AATAATGCGGTTTTCATGATTGTTCAGCCAGATAACGTTCCATCTTCTAATTGCGCTATT TACTCAACGTGTACTGTAAAGTATGAAAATTCCACCAATCCAATAAATTCTAGTGAATCT TTTGAAGAAAAAGATGTTTCTTCTAATATTTATAATGTTATTTTGACAGAGGACCAACCC AAGATAATCGTTCATAAGTATGTTGGTATTATGTCTACTGAGTTCAATAAGAACAAAGAA CAACAAGACAATACTAATATTGGTTTGGCCAAAATGATAGCTCTAAACAGTAAAGGCAAT TACGAGAAGCTTCTGTCAAGTCACAAACGTGCGTGGTATGACCTTTACAACGACGCCTTC ATTGAAATTCCTTCTGACAGTCTTTTAGAAATGACAGCAAGATCGTCCCTATTCCATTTA CTAGCAAATACAAGAGATTACAATGTCTCGAGCGATAGGGGTCTTCCCGTGGGAGTTTCT GGTTTGTCATCAGATTCCTATGGTGGTATGGTGTTCTGGGACGCAGATATATGGATGGAA CCTGCCCTATTGCCTTTCTTCCCAAATGTGGCTCAAAATATGAATAATTACAGAAATGCT ACACATTCGCAGGCAAAGTTAAATGCAGAGAAATATGGATACCCCGGAGCAATATACCCC TGGACATCTGGTAAGTACGCTAATTGTACTTCTACGGGACCTTGTGTCGATTACGAATAC CATATTAACGTTGATGTCGCTATGGCCTCCTTTTCCATATACTTGAATGGACACGAAGGG ATTGATGACGAGTATCTGAGATATACTACATGGCCAATTATCAAAAACGCAGCCCAATTT TTTACTGCTTATGTTAAGTACAATTCTTCCCTAGGATTGTATGAAACATATAATTTGACA GATCCCGACGAGTTTGCTAATCACATCAATAACGGGGCTTTCACGAATGCTGGCATTAAA ACACTTCTAAAGTGGGCAACAGACATTGGCAATCATCTCGGCGAGGTCGTTGACCCCAAA TGGAGTGAAATTTCCAAAGATATTTATATCCCTAGATCCTCATCTAACATCACTTTGGAA TATTCTGGTATGAATAGCTCAGTGGAGATTAAACAGGCGGATGTGACTTTAATGGTTTAC CCACTTGGATATATCAATGATGAATCCATATTGAACAATGCAATTAAAGATCTTTATTAT TATTCAGAAAGACAGTCTGCGTCTGGGCCTGCAATGACATATCCGGTTTTTGTGGCCGCA GCTGCTGGTCTGCTGAATCACGGCTCTTCTTCTCAAAGTTACTTATATAAATCGGTTCTT CCATACTTACGGGCTCCTTTCGCTCAATTTAGTGAGCAATCAGACGACAACTTTTTAACA AACGGATTAACCCAGCCAGCATTCCCCTTTTTAACAGCTAACGGTGGATTTCTACAGAGC ATTCTGTTTGGGTTAACAGGAATCCGATATTCTTATGAGGTTGATCCAGATACTAAAAAA ATTAACCGTTTGTTAAGGTTCAATCCAATAGAACTACCGTTGCTCCCTGGTGGTATCGCT ATTAGAAACTTCAAATATATGAACCAAGTTTTAGATATAATAATTGACGACCACAATGGT ACGATTGTTCATAAATCAGGAGATGTTCCTATTCATATAAAGATACCAAACAGATCTCTA ATACATGACCAGGATATCAACTTCTATAATGGTTCCGAAAACGAAAGAAAACCAAATCTA GAGCGTAGAGACGTCGACCGTGTTGGTGATCCAATGAGGATGGATAGGTATGGTACCTAT TATCTTTTAAAACCGAAACAAGAGCTTACAGTCCAACTGTTCAAGCCTGGCTTAAACGCA AGAAACAACATAGCGGAAAATAAGCAAATAACAAACTTGACGGCCGGCGTTCCTGGTGAC GTTGCATTCTCTGCTCTAGATGGGAATAATTACACGCATTGGCAACCCTTAGACAAAATT CACCGTGCGAAGCTATTGATTGATTTAGGTGAATACAACGAGAAAGAGATTACCAAGGGA ATGATTCTTTGGGGGCAGAGGCCCGCAAAAAACATTTCCATATCTATTTTGCCTCATTCT GAAAAAGTCGAAAATTTATTTGCGAACGTGACAGAAATTATGCAAAATTCGGGAAATGAT CAACTTCTTAATGAAACCATTGGTCAGCTTTTAGATAATGCCGGAATTCCTGTCGAGAAC GTTATTGATTTTGATGGCATAGAACAAGAGGATGATGAATCTTTGGATGATGTGCAAGCC TTATTGCACTGGAAGAAGGAAGACTTAGCCAAGCTAATTGAACAAATACCCAGACTTAAC TTTCTAAAAAGAAAATTTGTGAAAATTCTGGATAACGTGCCAGTGAGCCCAAGTGAGCCA TACTACGAAGCAAGTCGCAACCAGTCGTTAATCGAGATATTACCCAGTAATAGAACGACT TTCACTATTGATTATGATAAATTGCAGGTGGGTGATAAAGGGAACACAGATTGGAGGAAA ACAAGATACATAGTTGTGGCAGTACAAGGAGTGTATGATGATTATGATGATGATAACAAA GGAGCTACAATCAAGGAAATTGTTCTCAATGATTAA
Protein Properties
Pfam Domain Function
Protein Residues1211
Protein Molecular Weight136919.0
Protein Theoretical pI5.07
Signalling Regions
  • 1-
Transmembrane Regions
  • None
Protein Sequence>Vacuolar acid trehalase MKRIRSLWFNAEASYSNLNNSPSLRNKNSTGNNSRSKNYRSFSRFDLINSILLLMMLFLL AIFVTALYLTKSSRLTYSHASRAALFNPLGVISPSLGNHTLNYDPEARESSKKLYELLSD FNTAYYDDENMILGSNLFSKNTYSRQPYVANGYIGSRIPNIGFGYALDTLNFYTDAPGAL NNGWPLRNHRFAGAFVSDFYCLQPKLNSTNFPELDDVGYSTVISSIPQWTNLQFSLVNDS KWFNPQNVTLDDVTNYSQNLSMKDGIVTTELDWLNSQIHVKSEIWAHRHIHPLGVVSLEI SLNTDHLPSDFDSLDVNIWDILDFNTSHRTVLHSTGTDEKNNAVFMIVQPDNVPSSNCAI YSTCTVKYENSTNPINSSESFEEKDVSSNIYNVILTEDQPKIIVHKYVGIMSTEFNKNKE QQDNTNIGLAKMIALNSKGNYEKLLSSHKRAWYDLYNDAFIEIPSDSLLEMTARSSLFHL LANTRDYNVSSDRGLPVGVSGLSSDSYGGMVFWDADIWMEPALLPFFPNVAQNMNNYRNA THSQAKLNAEKYGYPGAIYPWTSGKYANCTSTGPCVDYEYHINVDVAMASFSIYLNGHEG IDDEYLRYTTWPIIKNAAQFFTAYVKYNSSLGLYETYNLTDPDEFANHINNGAFTNAGIK TLLKWATDIGNHLGEVVDPKWSEISKDIYIPRSSSNITLEYSGMNSSVEIKQADVTLMVY PLGYINDESILNNAIKDLYYYSERQSASGPAMTYPVFVAAAAGLLNHGSSSQSYLYKSVL PYLRAPFAQFSEQSDDNFLTNGLTQPAFPFLTANGGFLQSILFGLTGIRYSYEVDPDTKK INRLLRFNPIELPLLPGGIAIRNFKYMNQVLDIIIDDHNGTIVHKSGDVPIHIKIPNRSL IHDQDINFYNGSENERKPNLERRDVDRVGDPMRMDRYGTYYLLKPKQELTVQLFKPGLNA RNNIAENKQITNLTAGVPGDVAFSALDGNNYTHWQPLDKIHRAKLLIDLGEYNEKEITKG MILWGQRPAKNISISILPHSEKVENLFANVTEIMQNSGNDQLLNETIGQLLDNAGIPVEN VIDFDGIEQEDDESLDDVQALLHWKKEDLAKLIEQIPRLNFLKRKFVKILDNVPVSPSEP YYEASRNQSLIEILPSNRTTFTIDYDKLQVGDKGNTDWRKTRYIVVAVQGVYDDYDDDNK GATIKEIVLND
References
External Links
ResourceLink
Saccharomyces Genome Database ATH1
Uniprot IDP48016
Uniprot NameATH1_YEAST
GenBank Gene IDZ49274
Genebank Protein ID809591
General Reference
  • Destruelle, M., Holzer, H., Klionsky, D. J. (1995). "Isolation and characterization of a novel yeast gene, ATH1, that is required for vacuolar acid trehalase activity." Yeast 11:1015-1025.7502577
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Alizadeh, P., Klionsky, D. J. (1996). "Purification and biochemical characterization of the ATH1 gene product, vacuolar acid trehalase, from Saccharomyces cerevisiae." FEBS Lett 391:273-278.8764988