You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAminomethyltransferase, mitochondrial
Synonyms
  • Glycine cleavage system T protein
  • GCVT
  • Glycine decarboxylase complex subunit T
Gene NameGCV1
Enzyme Class
Biological Properties
General FunctionInvolved in aminomethyltransferase activity
Specific FunctionThe glycine cleavage system (glycine decarboxylase complex) catalyzes the degradation of glycine
Cellular LocationMitochondrion
SMPDB Pathways
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Nitrogen metabolismec00910 Map00910
One carbon pool by folateec00670 Map00670
SMPDB Reactions
Glycine + Tetrahydrofolic acidAmmonium + 5,10-Methylene-THF
water + 5,10-Methenyltetrahydrofolic acidN5-Formyl-THF
S-Aminomethyldihydrolipoylprotein; + Tetrahydrofolic acid5,10-Methylene-THF + Ammonia + dihydrolipoylprotein
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00091AmmoniaShow
YMDB00139Tetrahydrofolic acidShow
YMDB001765,10-Methenyltetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB00298N5-Formyl-THFShow
YMDB00423AmmoniumShow
YMDB00890waterShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
catalytic activity
transferase activity
aminomethyltransferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
serine family amino acid metabolic process
glycine metabolic process
metabolic process
glycine catabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR019C
Gene Sequence>1203 bp ATGTCTATAATCAAAAAAATTGTGTTTAAGAGATTCAACTCAACTTTGAAAAAAACTGCT CTTCATGACCTTCATGTGTCATTAGGCGGTACAATGGTACCATACGCAGGATATTCCATG CCCGTACTATACAAGGGACAGACTCATATTGAATCACATAATTGGACCAGGACAAACGCT GGTTTATTTGATGTTTCTCATATGTTACAAAGTAAGTTATCTGGTCCTCATTCTGTTAAG TTTCTGCAACGTGTAACGCCCACAGATTTCAATGCCTTGCCTGTTGGGTCAGGGACCTTA AGTGTTCTATTAAATCCACAGGGAGGCGTGGTAGACGATACCATCATCACTAAAGAAAAC GATGAGAATGAGTTCTATATTGTGACCAATGCTGGCTGTGCGGAAAGAGACACCGAGTTC TTTCACGATGAGCTACAAAATGGTTCTACTTTAGATTGTCAATGGAAAATCATTGAAGGT AGATCACTATTGGCATTGCAGGGTCCTAAAGCAAAAGATGTGTTGGAACCACTTTTATCA AAAACAGCTCCTGGAAAGGATCTAAAAGAGTTATTTTTTGGACAAAGACATGAATTTGCG TTAAAGGACGGTTCTTTGGTTCAAATTGCTAGAGGCGGGTACACTGGTGAAGATGGATTT GAGATAAGCATTGCAAATGAGAAAGCGGTTGAGTTTGCGGAGCAACTCTTGGCCAATCCA GTAATGAAGCCTATCGGACTGGCTGCTAGAGACAGTTTAAGGTTGGAAGCTGGTATGTGT TTGTATGGTCATGAATTGGACGAAAGTATCACACCAGTAGAAGCTGCGTTAAACTGGGTG ATTTCAAAGTCAAGAAGGGACCTAGTAGATCAAAAGTACTGGTTCAATGGCTATGCCAAG ATAATGGACCAGCTAAACAATAAAACGTATAGCAAGGTACGAGTCGGATTCAAATACTTG AAAAAGGGGCCAGCTGCCAGAAATGGTGTCAAGATCTTCTTGCCCGATGCCGAAACAGAG GTCGGCCTTGTTACATCAGGTAGTGCATCTCCAACTTTAAACAACATCAATATTGGACAA GCTTATGTACAGAAAGGTTACCACAAGAAGGGAACGAAGTTGCTTGTTCAAGTAAGGAAC AAGTTCTACCCGATTGAACTTGCTAAAATGCCTCTTGTGCCCACACATTACTACAAGCAG TAA
Protein Properties
Pfam Domain Function
Protein Residues400
Protein Molecular Weight44468.69922
Protein Theoretical pI9.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aminomethyltransferase, mitochondrial MSIIKKIVFKRFNSTLKKTALHDLHVSLGGTMVPYAGYSMPVLYKGQTHIESHNWTRTNA GLFDVSHMLQSKLSGPHSVKFLQRVTPTDFNALPVGSGTLSVLLNPQGGVVDDTIITKEN DDNEFYIVTNAGCAERDTEFFHDELQNGSTLDCQWKIIEGRSLLALQGPKAKDVLEPLLS KTAPGKDLKELFFGQRHEFALKDGSLVQIARGGYTGEDGFEISIANEKAVEFAEQLLANP VMKPIGLAARDSLRLEAGMCLYGHELDESITPVEAALNWVISKSRRDLVDQKYWFNGYAK IMDQLNNKTYSKVRVGFKYLKKGPAARNGVKIFLPDAETEVGLVTSGSASPTLNNINIGQ AYVQKGYHKKGTKLLVQVRNKFYPIELAKMPLVPTHYYKQ
References
External Links
ResourceLink
Saccharomyces Genome Database GCV1
Uniprot IDP48015
Uniprot NameGCST_YEAST
GenBank Gene IDL41522
Genebank Protein ID769682
General Reference
  • McNeil, J. B., Zhang, F., Taylor, B. V., Sinclair, D. A., Pearlman, R. E., Bognar, A. L. (1997). "Cloning, and molecular characterization of the GCV1 gene encoding the glycine cleavage T-protein from Saccharomyces cerevisiae." Gene 186:13-20.9047339
  • Eide, L. G., Sander, C., Prydz, H. (1996). "Sequencing and analysis of a 35.4 kb region on the right [corrected] arm of chromosome IV from Saccharomyces cerevisiae reveal 23 open reading frames." Yeast 12:1085-1090.8896275
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106