Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLong-chain-fatty-acid--CoA ligase 4
Synonyms
  • Fatty acid activator 4
  • Long-chain acyl-CoA synthetase 4
Gene NameFAA4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionEsterification, concomitant with transport, of exogenous long-chain fatty acids into metabolically active CoA thioesters for subsequent degradation or incorporation into phospholipids. Contributes, with FAA1, to the activation of imported myristate
Cellular LocationNot Available
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
Fatty acid metabolismPW002460 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
Fatty acid metabolismec00071 Map00071
SMPDB Reactions
Palmitic acid + Adenosine triphosphate + Coenzyme AAdenosine monophosphate + Pyrophosphate + Palmityl-CoA
Palmitic acid + Adenosine triphosphate + Coenzyme APalmityl-CoA + Adenosine monophosphate + Pyrophosphate
KEGG Reactions
Adenosine triphosphate + Coenzyme A + Palmitic acidAdenosine monophosphate + Pyrophosphate + Palmityl-CoA
Adenosine triphosphate + Coenzyme A + palmitoleic acidAdenosine monophosphate + Pyrophosphate + hexadec-2-enoyl-CoA
stearic acid + Adenosine triphosphate + Coenzyme AAdenosine monophosphate + Pyrophosphate + stearoyl-CoA
Adenosine triphosphate + Coenzyme A + Oleic acidAdenosine monophosphate + Pyrophosphate + oleoyl-CoA
Adenosine triphosphate + Linoleic acid + Coenzyme AAdenosine monophosphate + Pyrophosphate
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB001134-Phospho-L-aspartic acidShow
YMDB00219PyrophosphateShow
YMDB00301Palmityl-CoAShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00528myristoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00679myristic acidShow
YMDB00680Myristoleic acidShow
YMDB00681palmitoleic acidShow
YMDB00682stearic acidShow
YMDB00884Linoleic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR246W
Gene Sequence>2085 bp ATGACCGAACAATATTCCGTTGCAGTTGGCGAAGCCGCCAATGAGCATGAAACCGCTCCA AGAAGAAATATCAGGGTTAAAGACCAGCCTTTGATTAGACCCATAAACTCCTCAGCATCT ACACTGTACGAATTCGCCCTGGAATGTTTTACCAAGGGTGGTAAGAGAGACGGTATGGCA TGGAGAGATATTATAGATATACATGAGACGAAAAAAACCATAGTCAAGAGGGTGGATGGT AAGGATAAGCCCATCGAAAAAACATGGTTGTACTACGAACTGACTCCCTACATAACCATG ACATACGAGGAGATGATCTGCGTAATGCACGACATTGGACGTGGGCTGATAAAGATTGGT GTTAAACCTAACGGTGAGAACAAGTTCCACATCTTTGCCTCTACTTCTCACAAGTGGATG AAAACTTTTCTTGGTTGCATGTCACAAGGTATTCCTGTGGTCACCGCGTACGACACTTTG GGTGAGAGCGGTTTGATTCACTCCATGGTGGAAACAGATTCCGTCGCCATTTTCACGGAC AACCAGCTGTTGTCCAAATTAGCAGTTCCTTTGAAAACCGCCAAGAACGTAAAATTCGTC ATTCACAACGAACCCATCGATCCAAGTGACAAAAGACAAAATGGTAAGCTTTACAAGGCT GCCAAGGATGCTGTTGACAAAATCAAGGAAGTTAGACCGGACATAAAAATCTACAGTTTC GATGAAATTATTGAGATAGGTAAAAAGGCCAAGGACGAGGTTGAATTGCATTTCCCCAAG CCTGAAGATCCAGCTTGTATCATGTACACTTCTGGTTCCACTGGTACACCAAAGGGTGTG GTATTGACACATTACAACATTGTAGCTGGCATTGGTGGTGTGGGCCATAACGTTATCGGA TGGATTGGCCCAACAGACCGTATTATCGCATTCTTGCCATTGGCTCATATTTTTGAATTA ACCTTTGAATTCGAAGCGTTCTACTGGAATGGTATCCTAGGGTACGCCAATGTCAAGACT TTAACCCCAACTTCTACACGTAATTGCCAAGGTGACCTGATGGAGTTTAAACCTACCGTA ATGGTGGGTGTCGCCGCAGTTTGGGAAACAGTGAGAAAAGGTATCCTGGCCAAGATCAAC GAATTGCCCGGTTGGTCTCAAACGCTTTTCTGGACTGTCTATGCTTTGAAAGAGAGAAAT ATACCATGTAGCGGCTTGCTGAGTGGGTTGATCTTCAAGAGAATCAGAGAAGCAACCGGT GGAAACTTAAGGTTTATTCTGAACGGTGGGTCTGCAATCAGCATAGACGCCCAAAAATTC CTCTCCAACCTTCTATGTCCTATGCTCATTGGATATGGGCTAACTGAGGGTGTGGCTAAT GCCTGTGTCCTGGAGCCTGAACATTTTGATTACGGTATTGCTGGTGACCTTGTCGGAACT ATTACAGCTAAATTGGTGGATGTCGAAGATTTGGGCTATTTTGCCAAGAATAATCAAGGT GAATTGCTGTTTAAGGGTGCACCCATCTGTTCTGAATACTATAAGAATCCTGAAGAAACT GCTGCGGCCTTTACCGATGATGGCTGGTTCCGTACCGGTGATATCGCTGAATGGACCCCC AAGGGACAAGTTAAGATCATTGATAGAAAGAAAGGTTTGGTTAAGACCTTAAATGGTGAG TACATTGCATTGGAAAAATTAGAATCCATTTACAGATCAAATCCTTACGTCCAAAACATC TGTGTCTACGCTGATGAAAACAAAGTTAAGCCTGTCGGTATTGTGGTCCCTAACTTAGGA CACTTGTCTAAGCTGGCTATCGAATTAGGTATAATGGTACCAGGTGAAGATGTCGAAAGC TATATCCATGAAAAGAAGCTACAGGATGCCGGTTGCAAAGATATGCTGTCAACTGCCAAA TCTCAAGGCTTGAATGGTATTGAATTATTATGTGGCATTGTTTTCTTTGAAGAAGAATGG ACTCCAGAAAATGGCCTTGTTACATCCGCCCAAAAATTAAAGAGAAGAGATATTCTAGCG GCTGTCAAGCCAGATGTGGAAAGAGTTTATAAAGAAAACACTTAA
Protein Properties
Pfam Domain Function
Protein Residues694
Protein Molecular Weight77266.5
Protein Theoretical pI6.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Long-chain-fatty-acid--CoA ligase 4 MTEQYSVAVGEAANEHETAPRRNIRVKDQPLIRPINSSASTLYEFALECFTKGGKRDGMA WRDIIDIHETKKTIVKRVDGKDKPIEKTWLYYELTPYITMTYEEMICVMHDIGRGLIKIG VKPNGENKFHIFASTSHKWMKTFLGCMSQGIPVVTAYDTLGESGLIHSMVETDSVAIFTD NQLLSKLAVPLKTAKNVKFVIHNEPIDPSDKRQNGKLYKAAKDAVDKIKEVRPDIKIYSF DEIIEIGKKAKDEVELHFPKPEDPACIMYTSGSTGTPKGVVLTHYNIVAGIGGVGHNVIG WIGPTDRIIAFLPLAHIFELTFEFEAFYWNGILGYANVKTLTPTSTRNCQGDLMEFKPTV MVGVAAVWETVRKGILAKINELPGWSQTLFWTVYALKERNIPCSGLLSGLIFKRIREATG GNLRFILNGGSAISIDAQKFLSNLLCPMLIGYGLTEGVANACVLEPEHFDYGIAGDLVGT ITAKLVDVEDLGYFAKNNQGELLFKGAPICSEYYKNPEETAAAFTDDGWFRTGDIAEWTP KGQVKIIDRKKNLVKTLNGEYIALEKLESIYRSNPYVQNICVYADENKVKPVGIVVPNLG HLSKLAIELGIMVPGEDVESYIHEKKLQDAVCKDMLSTAKSQGLNGIELLCGIVFFEEEW TPENGLVTSAQKLKRRDILAAVKPDVERVYKENT
References
External Links
ResourceLink
Saccharomyces Genome Database FAA4
Uniprot IDP47912
Uniprot NameLCF4_YEAST
GenBank Gene IDZ48744
Genebank Protein ID732946
General Reference
  • Johnson, D. R., Knoll, L. J., Levin, D. E., Gordon, J. I. (1994). "Saccharomyces cerevisiae contains four fatty acid activation (FAA) genes: an assessment of their role in regulating protein N-myristoylation and cellular lipid metabolism." J Cell Biol 127:751-762.7962057
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106