You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAldehyde dehydrogenase [NAD(P)+] 1
SynonymsNot Available
Gene NameALD2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionAn aldehyde + NAD(P)(+) + H(2)O = an acid + NAD(P)H
Cellular LocationCytoplasm (Potential)
SMPDB Pathways
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Histidine metabolismec00340 Map00340
Phenylalanine metabolismec00360 Map00360
Tyrosine metabolismec00350 Map00350
SMPDB ReactionsNot Available
KEGG Reactions
NAD + 3-Aminopropionaldehyde + waterNADH + Beta-Alanine + hydron
Phenylacetaldehyde + NAD + waterNADH + hydron + Phenylacetic acid
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB000483-AminopropionaldehydeShow
YMDB00056Acetic acidShow
YMDB00110NADShow
YMDB00116PhenylacetaldehydeShow
YMDB00143NADHShow
YMDB00195Beta-AlanineShow
YMDB00412NAD(+)Show
YMDB00862hydronShow
YMDB00890waterShow
YMDB00891Phenylacetic acidShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 13
LocusYMR170C
Gene Sequence>1521 bp ATGCCTACCTTGTATACTGATATCGAAATCCCACAATTGAAAATCTCTTTAAAGCAACCG CTAGGGTGTTTTATCAACAATGAGTTTTGTCCATCATCAGATGGAAAGACCATCGAAACT GTGAACCCAGCTACTGGCGAACCGATAACATCCTTCCAAGCAGCTAACGAAAAGGATGTA GACAAAGCTGTGAAAGCTGCCAGGGCTGCTTTTGATAACGTTTGGTCGAAGACATCTTCT GAGCAACGTGGTATTTATCTTTCAAACTTATTAAAACTTATTGAGGAGGAGCAAGACACA CTTGCCGCATTAGAGACTTTAGACGCTGGAAAGCCTTACCATTCAAATGCCAAAGGTGAT TTGGCACAAATTTTACAGCTTACCAGATATTTTGCTGGGTCCGCTGATAAGTTTGACAAA GGTGCAACCATACCATTGACTTTTAACAAGTTTGCATATACTCTAAAAGTTCCTTTTGGC GTTGTTGCTCAAATCGTTCCATGGAATTATCCTCTAGCTATGGCTTGTTGGAAATTGCAA GGTGCCTTAGCAGCCGGTAACACGGTTATCATCAAACCTGCTGAGAATACCTCTCTATCT CTACTTTATTTTGCTACTTTAATTAAAAAAGCAGGTTTTCCACCTGGTGTTGTCAATATC GTTCCTGGTTATGGATCACTTGTAGGCCAAGCCCTAGCATCTCACATGGATATCGACAAA ATATCTTTTACGGGAAGCACCAAGGTCGGTGGATTTGTGTTGGAAGCTTCCGGCCAATCG AACCTTAAAGACGTTACACTAGAATGCGGTGGTAAGTCTCCTGCTCTCGTATTTGAAGAT GCAGACCTTGATAAGGCTATCGATTGGATAGCAGCTGGCATTTTCTACAATTCAGGACAG AATTGTACCGCAAACTCAAGAGTTTATGTTCAAAGTTCGATCTACGACAAGTTTGTTGAA AAGTTTAAAGAAACTGCAAAGAAGGAGTGGGATGTTGCAGGAAAATTTGATCCGTTTGAT GAGAAATGCATCGTTGGTCCAGTTATATCAAGTACACAGTATGACCGCATCAAAAGTTAC ATAGAACGTGGTAAAAGGGAGGAAAAGTTGGACATGTTCCAGACCTCTGAATTTCCTATT GGTGGAGCTAAAGGCTACTTCATTCCCCCAACCATCTTCACTGATGTCCCGCAAACATCG AAACTGTTACAGGATGAGATATTTGGCCCGGTTGTGGTTGTTAGCAAGTTCACAAATTAT GATGACGCTCTGAAGCTGGCTAATGATACTTGCTACGGGCTCGCCTCTGCGGTCTTCACA AAAGATGTCAAGAAAGCGCACATGTTTGCTCGCGATATTAAAGCAGGAACTGTTTGGATC AATCAATCTAACGATGAAGATGTTACCGTTCCTTTTGGCGGGTTTAAGATGAGTGGTATT GGTAGAGAACTAGGCGACAACGTCGTTGATACCTATCTACAAACAAAATCAGTTCACATG GATCTCTCTTTGGACAACTAA
Protein Properties
Pfam Domain Function
Protein Residues506
Protein Molecular Weight55187.39844
Protein Theoretical pI5.24
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Aldehyde dehydrogenase [NAD(P)+] 1 MPTLYTDIEIPQLKISLKQPLGLFINNEFCPSSDGKTIETVNPATGEPITSFQAANEKDV DKAVKAARAAFDNVWSKTSSEQRGIYLSNLLKLIEEEQDTLAALETLDAGKPYHSNAKGD LAQILQLTRYFAGSADKFDKGATIPLTFNKFAYTLKVPFGVVAQIVPWNYPLAMACWKLQ GALAAGNTVIIKPAENTSLSLLYFATLIKKAGFPPGVVNIVPGYGSLVGQALASHMDIDK ISFTGSTKVGGFVLEASGQSNLKDVTLECGGKSPALVFEDADLDKAIDWIAAGIFYNSGQ NCTANSRVYVQSSIYDKFVEKFKETAKKEWDVAGKFDPFDEKCIVGPVISSTQYDRIKSY IERGKREEKLDMFQTSEFPIGGAKGYFIPPTIFTDVPQTSKLLQDEIFGPVVVVSKFTNY DDALKLANDTCYGLASAVFTKDVKKAHMFARDIKAGTVWINSSNDEDVTVPFGGFKMSGI GRELGQSGVDTYLQTKAVHINLSLDN
References
External Links
ResourceLink
Saccharomyces Genome Database ALD2
Uniprot IDP47771
Uniprot NameALDH2_YEAST
GenBank Gene IDX85987
Genebank Protein ID758648
General Reference
  • Miralles, V. J., Serrano, R. (1995). "A genomic locus in Saccharomyces cerevisiae with four genes up-regulated by osmotic stress." Mol Microbiol 17:653-662.8801420
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Navarro-Avino, J. P., Prasad, R., Miralles, V. J., Benito, R. M., Serrano, R. (1999). "A proposal for nomenclature of aldehyde dehydrogenases in Saccharomyces cerevisiae and characterization of the stress-inducible ALD2 and ALD3 genes." Yeast 15:829-842.10407263
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106