You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePolygalacturonase
Synonyms
  • PG
  • PGase SM
  • Pectinase
Gene NamePGU1
Enzyme Class
Biological Properties
General FunctionInvolved in polygalacturonase activity
Specific FunctionRandom hydrolysis of (1->4)-alpha-D- galactosiduronic linkages in pectate and other galacturonans
Cellular LocationCytoplasmic
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose and glucuronate interconversionsec00040 Map00040
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG Reactions
water + Pectin aldehydo-D-galacturonate
Metabolites
YMDB IDNameView
YMDB00674aldehydo-D-galacturonateShow
YMDB00890waterShow
YMDB00904PectinShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
polygalacturonase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR153W
Gene Sequence>1086 bp ATGATTTCTGCTAATTCATTACTTATTTCCACTTTGTGCGCTTTTGCGATCGCAACACCT TTGTCAAAAAGAGATTCCTGTACCCTAACAGGATCTTCTTTGTCTTCACTCTCAACCGTG AAAAAATGTAGCAGCATCGTTATTAAAGACTTAACTGTCCCAGCTGGACAGACTTTAGAT TTAACTGGGTTAAGCAGTGGTACTACTGTTACGTTTGAAGGCACAACCACATTTCAGTAC AAGGAATGGAGCGGCCCTTTAATTTCAATCTCAGGGTCTAAAATCAGCGTTGTTGGTGCT TCGGGACATACCATTGATGGTCAAGGAGCAAAATGGTGGGATGGCTTAGGTGATAGCGGT AAAGTCAAACCGAAGTTTGTAAAGTTGGCGTTGACGGGAACATCTAAGGTCACCGGATTG AATATTAAAAATGCTCCACACCAAGTCTTCAGCATCAATAAATGTTCAGATTTAACCATC AGCGACATAACAATTGATATCAGAGACGGTGATTCGGCTGGTGGTCATAATACGGATGGG TTTGATGTTGGTAGTTCTAGTAACGTCTTAATTCAAGGATGTACTGTTTATAATCAGGAT GACTGTATTGCTGTGAATTCCGGTTCAACTATTAAATTTATGAACAACTACTGCTACAAT GGCCATGGTATTTCTGTAGGTTCTGTTGGTGGCCGTTCTGATAATACAGTCAATGGTTTC TGGGCTGAAAATAACCATGTTATCAACTCTGACAACGGGTTGAGAATAAAAACCGTAGAA GGTGCGACAGGCACAGTCACTAATGTCAACTTTATCAGTAATAAAATTAGCGGCATAAAA AGTTATGGTATTGTTATCGAAGGCGATTATTTGAATAGTAAGACTACTGGAACTGCTACA GGTGGCGTTCCCATTTCGAATTTAGTAATGAAGGATATCACCGGGAGCGTGAACTCCACA GCGAAGAGGGTTAAAATTTTGGTGAAAAACGCTACTAACTGGCAATGGTCTGGGGTGTCA ATTACCGGTGGTTCTTCCTATTCTGGATGTTCTGGAATCCCATCTGGATCTGGTGCAAGC TGTTAA
Protein Properties
Pfam Domain Function
Protein Residues361
Protein Molecular Weight37286.60156
Protein Theoretical pI8.31
Signalling Regions
  • 1-18
Transmembrane Regions
  • None
Protein Sequence>Polygalacturonase MISANSLLISTLCAFAIATPLSKRDSCTLTGSSLSSLSTVKKCSSIVIKDLTVPAGQTLD LTGLSSGTTVTFEGTTTFQYKEWSGPLISISGSKISVVGASGHTIDGQGAKWWDGLGDSG KVKPKFVKLALTGTSKVTGLNIKNAPHQVFSINKCSDLTISDITIDIRDGDSAGGHNTDG FDVGSSSNVLIQGCTVYNQDDCIAVNSGSTIKFMNNYCYNGHGISVGSVGGRSDNTVNGF WAENNHVINSDNGLRIKTVEGATGTVTNVNFISNKISGIKSYGIVIEGDYLNSKTTGTAT GGVPISNLVMKDITGSVNSTAKRVKILVKNATNWQWSGVSITGGSSYSGCSGIPSGSGAS C
References
External Links
ResourceLink
Saccharomyces Genome Database PGU1
Uniprot IDP47180
Uniprot NamePGLR_YEAST
GenBank Gene IDAB011818
Genebank Protein ID2951783
General Reference
  • Blanco, P., Sieiro, C., Reboredo, N. M., Villa, T. G. (1998). "Cloning, molecular characterization, and expression of an endo-polygalacturonase-encoding gene from Saccharomyces cerevisiae IM1-8b." FEMS Microbiol Lett 164:249-255.9682473
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Blanco, P., Sieiro, C., Diaz, A., Villa, T. G. (1994). "Production and partial characterization of an endopolygalacturonase from Saccharomyces cerevisiae." Can J Microbiol 40:974-977.7804908