You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative nitronate monooxygenase
Synonyms
  • Nitroalkane oxidase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nitronate monooxygenase activity
Specific FunctionCatalyzes the oxidation of alkyl nitronates to produce the corresponding carbonyl compounds and nitrites
Cellular LocationNot Available
SMPDB Pathways
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nitrogen metabolismec00910 Map00910
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00085Flavin MononucleotideShow
YMDB00135NitriteShow
YMDB00370EthylnitronateShow
YMDB00686FMNH2Show
GO Classification
Component
Not Available
Function
oxidoreductase activity
monooxygenase activity
oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of one atom of oxygen (internal monooxygenases or internal mixed function oxidases)
nitronate monooxygenase activity
catalytic activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome LocationNot Available
LocusYJR149W
Gene Sequence>1215 bp ATGTACTTTTTAAACCAACTAATATTTCAAGACGTTTCCGTAATGTCGGTGGATAAAAGA GAAGATATGAGCAGATCTTTCCAAAAATGTTTAAACTTGAGATACCCTATCATCCAGGCC CCTATGGCGGGGGTCACGACTATTGAAATGGCCGCTAAGGCTTGTATTGCGGGCGCCATA GCTTCACTACCCCTATCCCACTTAGACTTCAGAAAGGTCAATGATATTGAAAAGCTTAAA CTGATGGTTTCACAATTCAGAGATCAAGTAGCCGATGAATCTTTAGAGGGCAATCTCAAC CTAAACTTTTTTTGCCATGATATCGTTGATAAACCGACCGATCTTCAAACAGCTAACTGG GCGAAGCTATACAGAAAGTCTATGAATGTGCCGATTGATATGAATGAGATTAAATTCGAT AATGGTAATGTATCTTTTAAGGCATTTGAAAAAGAAAATGCTCTTCAAGATTTTTTCCAG TACCTATCAGATGGCTTTAGGCCTAAAATCATTAGTTTCCATTTTGGCCATCCGTCGAAA TCTACAATAGAATATTTACAAAAAATTGGAATTCTAATTTTTGTGACTGCCACCTCTGTA AGAGAAGTTCGATTGTTAGCACGTCTCGGCATTAATGGCATAGTGTGTCAAGGCTATGAA GCGGGAGGACATAGAGGAAATTTCTTAGTAAATGACCCCAAAGATGATGAAAACTTATCA ACTGTACAATTGGTGAAAAGAACAGTTGATGAACTTGCTGAAATGAAAAATAAAGGTCTT ATACATGCTACTCCCTTTGTCATTGCAGCAGGTGGTATAATGGATTCCAAAGATATATCA TACATGTTATCACAGCAAGCAGACGCTGTTCAAGTGGGGACTGCTTTTCTTGGTTGCAGT GAATCCAATGCATCAAAAAACTTTTCAAGCCCCTTCACTCGAGAAACAACAACTAAAATG GTTAATATAATATCAGGAAAGCCTGCAAGGACCATCTCTACTCCTTTTATCGAAAAAGTC ATTGCTAATTTTCAAGGTGAGGAGCTTCCTCCATATGGCTACATGTATAGTGCTTTCAAG CAAGTAAGAAAAAAGTATCCAGAATTGGCTAACTTTATTTTAGCTGGACAAGGATTTCAG AATGTCCAATCAGGAATCACAACAGACAAGAAAATTGAAACTATGGGCGCAAGATTGAAA ATTGTCGGAAAATAA
Protein Properties
Pfam Domain Function
Protein Residues404
Protein Molecular Weight45142.60156
Protein Theoretical pI8.65
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative nitronate monooxygenase MYFLNQLIFQDVSVMSVDKREDMSRSFQKCLNLRYPIIQAPMAGVTTIEMAAKACIAGAI ASLPLSHLDFRKVNDIEKLKLMVSQFRDQVADESLEGNLNLNFFCHDIVDKPTDLQTANW AKLYRKSMNVPIDMNEIKFDNGNVSFKAFEKENALQDFFQYLSDGFRPKIISFHFGHPSK STIEYLQKIGILIFVTATSVREVRLLARLGINGIVCQGYEAGGHRGNFLVNDPKDDENLS TVQLVKRTVDELAEMKNKGLIHATPFVIAAGGIMDSKDISYMLSQQADAVQVGTAFLGCS ESNASKNFSSPFTRETTTKMVNIISGKPARTISTPFIEKVIANFQGEELPPYGYMYSAFK QVRKKYPELANFILAGQGFQNVQSGITTDKKIETMGARLKIVGK
References
External Links
ResourceLink
Saccharomyces Genome Database YJR149W
Uniprot IDP47177
Uniprot Name2NDP_YEAST
GenBank Gene IDZ49649
Genebank Protein ID1015899
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106