You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameXanthine phosphoribosyltransferase 1
Synonyms
  • XPRT
Gene NameXPT1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleoside metabolic process
Specific FunctionMay act as a xanthine phosphoribosyltransferase involved in the synthesis of purine nucleotides. Such activity is however unclear in vivo
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Xanthine + Phosphoribosyl pyrophosphatePyrophosphate + Xanthylic acid
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00263XanthineShow
YMDB00289Xanthylic acidShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB006999H-xanthineShow
GO Classification
Component
Not Available
Function
Not Available
Process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside metabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR133W
Gene Sequence>630 bp ATGGCCGAAAATGAGAGAATGTACATCTCCTATAATAATATTCACAAGCTTTGTCAGGGA GTGGCTAAACATATCTTAGCTAGAAACGAAAGACCTGATATTATTATCGCCATCACTGGT GGTGGTATGATCCCCGCAAGAATTATTAGGTCCTTTTTGAAAACTAAAGGACAAAAGAAT ATTCCGATTCAGGCCATCGGCCTATCTTTGTATGAAGATTTAGGGTTGGATAATAGCGTC GAAACTATCGGCAAAGAGGTCATCAGAACACAATGGCTGGACTTCGGTGCTTTGAACCAA CATTTCGATTCCTTAATTGGTAAAAAGGTCCTAATTGTGGATGAAGTTGACGATACTAGA ACTACCCTCCACTATGCTGTTTCTGAGCTGGAAAAAGAGATTGCTGAACAACAAAAGGTT TTGAATAGAATGAGTGAGGAAACCGTTATTTCTATCTTTGTTCTACATAATAAGGACAAA CCAAAGAGAGCTGGACTACCTGACTCCATGATGAATTCTGGACGTTACATTGCTGCGCAA ACTGTCCCTGATAAGTGGTTGTGCTATCCATGGGACGCTGAAGATATCGAAGAACATACC ATGCTCGCTAAGGCTCAAGGTCATGACTGA
Protein Properties
Pfam Domain Function
Protein Residues209
Protein Molecular Weight23671.0
Protein Theoretical pI6.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Xanthine phosphoribosyltransferase 1 MAENERMYISYNNIHKLCQGVAKHILARNERPDIIIAITGGGMIPARIIRSFLKTKGQKN IPIQAIGLSLYEDLGLDNSVETIGKEVIRTQWLDFGALNQHFDSLIGKKVLIVDEVDDTR TTLHYAVSELEKEIAEQQKVLNRMSEETVISIFVLHNKDKPKRAGLPDSMMNSGRYIAAQ TVPDKWLCYPWDAEDIEEHTMLAKAQGHD
References
External Links
ResourceLink
Saccharomyces Genome Database XPT1
Uniprot IDP47165
Uniprot NameXPT1_YEAST
GenBank Gene IDZ49633
Genebank Protein ID1015868
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Guetsova, M. L., Crother, T. R., Taylor, M. W., Daignan-Fornier, B. (1999). "Isolation and characterization of the Saccharomyces cerevisiae XPT1 gene encoding xanthine phosphoribosyl transferase." J Bacteriol 181:2984-2986.10217799
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956