You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoinositide 3-phosphatase
Synonyms
  • Yeast myotubularin-related protein 1
Gene NameYMR1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphatase activity
Specific FunctionInvolved in the control of phosphotidylinositol 3- phosphate (PI(3)P)-dependent signaling and in the maintenance of endosomal system integrity
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
1-phosphatidyl-1D-myo-inositol 3-phosphate + waterphosphate + 1-Phosphatidyl-D-myo-inositol + hydron
Metabolites
YMDB IDNameView
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
phosphoprotein phosphatase activity
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
protein tyrosine phosphatase activity
Process
dephosphorylation
metabolic process
cellular metabolic process
phosphorus metabolic process
phosphate metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR110W
Gene Sequence>2067 bp ATGGAGTACATCAAGATTGCCAAAGTATCTAATGTAGTGCTGCATAGAAGAGGTACGGCC ACACAAGGTACTTTACATTTGACTACTCACCATTTGATCTTTGAGTCACCACAATTGTCG ACGGAATTTTGGTTTCCATATCCTTTGATCTATGGAGTGCATAAAAACCCGGGTAGTACA TTACTGTCCAAGTTGACTTCCACTAATCAAATCCAATTGGAGGGAACGGATTCACAGAAT TACAAGCTTTACCAGGGTAAGGATCTATGGTCTTTTGTAAATATCAAGGTAATTGGGAAA GATTATGCGGTATTCTCATTGGATTTCGGTGGTGATTTACATCTACAGGCAAGAAAGGTG TATGATTCCATCTTAAATTTGACGGTCCTGTCCAATATCACGCAACTATATGCATTTATT TACATATCCAACAATCTGGAAAGGAAACTACCTTCACCCGATAGCTGGGATATATATGAC CCAATTAAGGAATTTCGAAGGCAGGGCCTCGACAGTAAAGATGAAACATGTCCTTGGAGG CTATCCACGGTAAACGAACACTATGAATTTTGTCCAACGTATCCCTCAAAACTTTTTGTA CCAAGATCCACGTCAGATATATTATTGAAGCATGCTTCGAAGTTTAGATCACAGAAAAGA ATTCCTGTTTTAACTTATCATCACAAGGCAACAGATTGCAACATTCTTAGGTCATCTCAA CCATTACCGGGGTTGATCAATCAGAGGTCCATTCAAGATGAAAAATTAGTTTGGGAAAGC TTCAACTCATTTTGTAATAAAGATATTAGAAGAACGAAACATGTAATAGTAGATGCCAGA CCCAGAACAAATGCATTAGCACAGATGGCGTTGGGTGGCGGGACAGAAAATATGGATAAT TATAATTTTTTTTTAGCTGATAACAATATGGGTGTCGATAAAAGTCTAAAACTGCCCACA GTTACACGGTTATTTCTTGGTATAGATAACATTCATATTGTTTCCAACACAGCTGCATAC ATGACGGAAGTTATCTGCCAAGGTGGCGATTTGAATTTACCACTGGAACAGAATTTAATT AGGAGTCAAAAATTTTCCAATTGGTTGAAGTTGAACACTCTTATTTTAAAATCCGTTGAT ATGCTTTTAAAGTCCATCATTTTCAATCATTCCAACGTTTTGGTTCATTGTTCTGACGGT TGGGACAGAACCAGTCAAGTTGTATCACTATTAGAAATTTGTTTGGATCCTTTCTATAGA ACTTTTGAAGGTTTTATGATCCTAGTGGAAAAAGATTGGTGCTCTTTTGGTCACCGGTTT TTGGAAAGAAGTGGTCATTTAAACTCTGATATTAGATTTCATGATAACACTATGCATTCC AACTTCAACGATGTGGATACCAATGGCGATGATCTTGACATAGGTGTTAACACTCAAGAC GATTATGCTGAAGATGATGAAGGAGGTGAAGATGAGACGAATTTAATTAATTTGAGTAGA ATTTCCAAAAAATTTAACGAAAACTTTAAATTGAACAAGAAAAGTCTAAAGTTCGTCTCC CCAGTTTTCCAACAATTTTTAGACTGTGTATACCAACTTTTGACGCAAAACCCAGATCTA TTTGAATTCAACGAAAGATTTTTAAGAAGACTAGTTTACCACTTGTATTCATGCCAATAT GGAACATTCCTTTCCAATAGCGAGAAGGAGAAATTTCAACAGAATTTGCCAAACAAGACT AAAAGTGTCTGGGACTACTTCAGATCTAGAAGAAAGCAGTTCATAAATCCAAATTTCATA CAGAGAAAAAGAAGCGGCATGAATGAGCACGATCAAAACCTTGAAGAGGAAGAAAAAGTG GAGTGGATTTCGCCGGATCTGAAGAAAGTCCAATGGTGGTGGCAGTTATATGGAAGAAAA GATTCAGAAATGAATGATGAATTACGCCATAAACGAGACTCAGTACCCATATCGGTGGAT AAAAAGAGTAAAGAGCATAGTAATTCCGATGGCGGTAAGGGTTTAAATTTGTCAATTTTT GGATTTGATATGTTTAATAGAAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues688
Protein Molecular Weight80151.10156
Protein Theoretical pI7.65
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoinositide 3-phosphatase MEYIKIAKVSNVVLHRRGTATQGTLHLTTHHLIFESPQLSTEFWFPYPLIYGVHKNPGST LLSKLTSTNQIQLEGTDSQNYKLYQGKDLWSFVNIKVIGKDYAVFSLDFGGDLHLQARKV YDSILNLTVLSNITQLYAFIYISNNLERKLPSPDSWDIYDPIKEFRRQGLDSKDETCPWR LSTVNEHYEFCPTYPSKLFVPRSTSDILLKHASKFRSQKRIPVLTYHHKATDCNILRSSQ PLPGLINQRSIQDEKLVWESFNSFCNKDIRRTKHVIVDARPRTNALAQMALGGGTENMDN YNFFLADNNMGVDKSLKLPTVTRLFLGIDNIHIVSNTAAYMTEVICQGGDLNLPLEQNLI RSQKFSNWLKLNTLILKSVDMLLKSIIFNHSNVLVHCSDGWDRTSQVVSLLEICLDPFYR TFEGFMILVEKDWCSFGHRFLERSGHLNSDIRFHDNTMHSNFNDVDTNGDDLDIGVNTQD DYAEDDEGGEDETNLINLSRISKKFNENFKLNKKSLKFVSPVFQQFLDCVYQLLTQNPDL FEFNERFLRRLVYHLYSCQYGTFLSNSEKEKFQQNLPNKTKSVWDYFRSRRKQFINPNFI QRKRSGMNEHDQNLEEEEKVEWISPDLKKVQWWWQLYGRKDSEMNDELRHKRDSVPISVD KKSKEHSNSDGGKGLNLSIFGFDMFNRK
References
External Links
ResourceLink
Saccharomyces Genome Database YMR1
Uniprot IDP47147
Uniprot NameYMR1_YEAST
GenBank Gene IDZ49610
Genebank Protein ID1015824
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Kinney, D. M., Lusty, C. J. (1989). "Arginine restriction induced by delta-N-(phosphonacetyl)-L-ornithine signals increased expression of HIS3, TRP5, CPA1, and CPA2 in Saccharomyces cerevisiae." Mol Cell Biol 9:4882-4888.2689869
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Parrish, W. R., Stefan, C. J., Emr, S. D. (2004). "Essential role for the myotubularin-related phosphatase Ymr1p and the synaptojanin-like phosphatases Sjl2p and Sjl3p in regulation of phosphatidylinositol 3-phosphate in yeast." Mol Biol Cell 15:3567-3579.15169871
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956