You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenosine kinase
SynonymsNot Available
Gene NameADO1
Enzyme Class
Biological Properties
General FunctionInvolved in adenosine kinase activity
Specific FunctionATP dependent phosphorylation of adenosine and other related nucleoside analogs to monophosphate derivatives. ADO1 does not play a major role in adenine utilization in yeast. Its physiological role could primarily be to recycle adenosine produced by the methyl cycle
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine + Adenosine triphosphateAdenosine monophosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00058AdenosineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
kinase activity
nucleobase, nucleoside, nucleotide kinase activity
nucleoside kinase activity
catalytic activity
adenosine kinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
biosynthetic process
cellular biosynthetic process
heterocycle biosynthetic process
purine salvage
metabolic process
purine ribonucleoside salvage
Gene Properties
Chromosome Locationchromosome 10
LocusYJR105W
Gene Sequence>1023 bp ATGACCGCACCATTGGTAGTATTGGGTAACCCACTTTTAGATTTCCAAGCCGACGTCACG GCTGAATACCTGGCCAAGTATTCTCTAAAGGAAAACGACGCAATTTTGGTCGATGCCAAA TCAGGCGATGCTAAGATGGCTATTTTTGACGAGCTCTTACAGATGCCAGAAACAAAGCTT GTTGCAGGTGGTGCTGCTCAAAACACTGCTAGAGGGGCAGCATACGTTTTGGGCGCCGGC CAGGTGGTGTACTTCGGTTCCGTCGGTAAGGACAAGTTCAGCGAGAGATTGCTTAACGAA AACGAAAAAGCTGGTGTCAAGTCTATGTACCAAGTTCAAAATGATATTGGTACCGGTAAG TGTGCCGCATTAATCACTGGCCATAACCGGTCCTTGGTCACTGACTTGGGTGCTGCCAAT TTCTTTACTCCAGACCACTTGGACAAGCATTGGGACTTGGTCGAAGCAGCTAAGCTCTTC TACATCGGTGGTTTCCACTTGACCGTGTCTCCAGACGCTATCGTTAAGTTGGGCCAACAT GCTAAAGAGAACAGCAAACCTTTCGTGTTGAACTTTAGTGCTCCTTTCATTCCTCATGTC TTCAAAGACGCATTGGCCAGAGTTTTGCCTTATGCTACCGTCATCATCGCTAACGAATCG GAGGCCGAAGCCTTTTGCGACGCCTTCCAATTAGACTGTGCCAACACTGATTTGGAAGCT ATTGCTCAAAGAATTGTCAAGGACTCTCCAGTTGAAAAGACTGTCATCTTCACCCACGGT GTCGAACCAACAGTGGTCGTGTCCTCCAAGGGTACCAGCACATATCCAGTCAAACCTTTG GACTCTTCTAAGATCGTCGACACCAACGGTGCTGGTGACGCCTTCGCTGGTGGCTTTATG GCTGGGTTGACTAAAGGTGAAGATTTGGAAACCTCTATTGACATGGGTCAATGGCTAGCT GCTTTGTCTATTCAAGAAGTTGGTCCCTCTTACCCTTCCGAAAAAATATCTTACTCTAAA TAG
Protein Properties
Pfam Domain Function
Protein Residues340
Protein Molecular Weight36372.0
Protein Theoretical pI4.77
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenosine kinase MTAPLVVLGNPLLDFQADVTAEYLAKYSLKENDAILVDAKSGDAKMAIFDELLQMPETKL VAGGAAQNTARGAAYVLGAGQVVYFGSVGKDKFSERLLNENEKAGVKSMYQVQNDIGTGK CAALITGHNRSLVTDLGAANFFTPDHLDKHWDLVEAAKLFYIGGFHLTVSPDAIVKLGQH AKENSKPFVLNFSAPFIPHVFKDALARVLPYATVIIANESEAEAFCDAFQLDCANTDLEA IAQRIVKDSPVEKTVIFTHGVEPTVVVSSKGTSTYPVKPLDSSKIVDTNGAGDAFAGGFM AGLTKGEDLETSIDMGQWLAALSIQEVGPSYPSEKISYSK
References
External Links
ResourceLink
Saccharomyces Genome Database ADO1
Uniprot IDP47143
Uniprot NameADK_YEAST
GenBank Gene IDAY558082
Genebank Protein ID45270054
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Lecoq, K., Belloc, I., Desgranges, C., Daignan-Fornier, B. (2001). "Role of adenosine kinase in Saccharomyces cerevisiae: identification of the ADO1 gene and study of the mutant phenotypes." Yeast 18:335-342.11223943
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Barrado, P., Rodriguez, M. J., Jimenez, A., Fernandez Lobato, M. (2003). "Expression in Escherichia coli of a recombinant adenosine kinase from Saccharomyces cerevisiae: purification, kinetics and substrate analyses." Yeast 20:1145-1150.14558146