You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIndoleamine 2,3-dioxygenase family protein
Synonyms
  • Biosynthesis of nicotinic acid protein 2
Gene NameBNA2
Enzyme Class
Biological Properties
General FunctionInvolved in heme binding
Specific FunctionRequired for biosynthesis of nicotinic acid
Cellular LocationNot Available
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Tryptophan metabolismec00380 Map00380
SMPDB Reactions
L-Tryptophan + oxygenN'-Formylkynurenine
L-Tryptophanoxygen + N'-Formylkynurenine
KEGG Reactions
oxygen + L-TryptophanN-Formyl-L-kynurenine
Metabolites
YMDB IDNameView
YMDB00126L-TryptophanShow
YMDB00234N'-FormylkynurenineShow
YMDB00725N-Formyl-L-kynurenineShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
cation binding
metal ion binding
transition metal ion binding
iron ion binding
heme binding
binding
ion binding
Process
Not Available
Gene Properties
Chromosome Locationchromosome 10
LocusYJR078W
Gene Sequence>1362 bp ATGAACAACACTTCCATAACCGGACCACAAGTACTACATAGAACAAAAATGAGACCACTA CCAGTGCTAGAAAAATACTGTATCTCGCCACATCATGGGTTTTTGGACGACCGGTTACCC TTGACCAGACTGAGCAGCAAGAAATATATGAAATGGGAAGAAATCGTTGCTGACCTGCCC TCTCTTTTGCAAGAGGATAACAAGGTGCGGAGCGTCATCGATGGGCTGGATGTCTTGGAC TTGGATGAGACGATCTTGGGCGACGTCAGGGAGCTCAGAAGAGCATATTCCATTTTGGGG TTTATGGCGCACGCTTATATTTGGGCCAGCGGAACTCCCCGGGATGTATTACCGGAGTGT ATTGCAAGGCCACTGTTGGAGACAGCACATATTTTGGGTGTGCCACCGTTAGCTACGTAC TCCTCGTTGGTGTTATGGAACTTCAAAGTGACCGACGAGTGCAAGAAAACGGAAACCGGG TGTTTGGACTTGGAAAATATTACAACGATAAACACATTTACGGGAACCGTTGACGAAAGT TGGTTTTATCTGGTCAGCGTGCGGTTTGAAAAAATCGGCAGCGCTTGTTTAAACCATGGG TTGCAGATATTGAGAGCCATTAGAAGCGGTGATAAAGGAGACGCTAACGTGATAGACGGG TTGGAGGGCTTGGCTGCAACGATCGAAAGGTTATCGAAAGCCTTGATGGAAATGGAGCTT AAGTGTGAACCCAATGTATTTTATTTCAAGATAAGACCATTTTTGGCCGGGTGGACGAAT ATGTCGCATATGGGGTTACCACAGGGTGTTAGGTATGGAGCGGAAGGACAGTATCGGATC TTTTCTGGCGGGTCCAATGCGCAAAGCTCGTTGATACAGACACTGGACATCCTTTTGGGT GTGAAACACACTGCGAATGCTGCGCATTCTTCCCAAGGAGACAGCAAGATCAATTATCTG GACGAAATGAAAAAATACATGCCAAGAGAACATCGTGAATTTCTTTACCATTTGGAATCG GTATGTAATATTCGCGAATACGTTTCTCGTAACGCTTCTAACCGTGCATTGCAAGAGGCC TATGGACGTTGCATTTCCATGCTGAAAATATTTAGAGATAACCACATTCAAATTGTTACC AAGTACATTATTTTGCCCTCCAATTCAAAGCAACACGGCTCCAATAAGCCGAACGTACTA AGTCCAATCGAGCCCAATACCAAAGCAAGTGGTTGTTTAGGGCATAAAGTTGCCTCATCT AAGACTATCGGAACCGGTGGTACAAGATTAATGCCCTTCTTAAAGCAGTGCAGGGACGAG ACTGTCGCCACTGCGGACATTAAAAATGAAGATAAAAATTGA
Protein Properties
Pfam Domain Function
Protein Residues453
Protein Molecular Weight50774.80078
Protein Theoretical pI8.11
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Indoleamine 2,3-dioxygenase family protein MNNTSITGPQVLHRTKMRPLPVLEKYCISPHHGFLDDRLPLTRLSSKKYMKWEEIVADLP SLLQEDNKVRSVIDGLDVLDLDETILGDVRELRRAYSILGFMAHAYIWASGTPRDVLPEC IARPLLETAHILGVPPLATYSSLVLWNFKVTDECKKTETGCLDLENITTINTFTGTVDES WFYLVSVRFEKIGSACLNHGLQILRAIRSGDKGDANVIDGLEGLAATIERLSKALMEMEL KCEPNVFYFKIRPFLAGWTNMSHMGLPQGVRYGAEGQYRIFSGGSNAQSSLIQTLDILLG VKHTANAAHSSQGDSKINYLDEMKKYMPREHREFLYHLESVCNIREYVSRNASNRALQEA YGRCISMLKIFRDNHIQIVTKYIILPSNSKQHGSNKPNVLSPIEPNTKASGCLGHKVASS KTIGTGGTRLMPFLKQCRDETVATADIKNEDKN
References
External Links
ResourceLink
Saccharomyces Genome Database BNA2
Uniprot IDP47125
Uniprot NameI23O_YEAST
GenBank Gene IDL47993
Genebank Protein ID1019699
General Reference
  • Huang, M. E., Manus, V., Chuat, J. C., Galibert, F. (1996). "Analysis of a 62 kb DNA sequence of chromosome X reveals 36 open reading frames and a gene cluster with a counterpart on chromosome XI." Yeast 12:869-875.8840504
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Panozzo, C., Nawara, M., Suski, C., Kucharczyka, R., Skoneczny, M., Becam, A. M., Rytka, J., Herbert, C. J. (2002). "Aerobic and anaerobic NAD+ metabolism in Saccharomyces cerevisiae." FEBS Lett 517:97-102.12062417
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106