Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative lipoate-protein ligase A
Synonyms
  • Altered inheritance rate of mitochondria protein 22
Gene NameAIM22
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes both the ATP-dependent activation of exogenously supplied lipoate to lipoyl-AMP and the transfer of the activated lipoyl onto the lipoyl domains of lipoate-dependent enzymes
Cellular LocationNot Available
SMPDB Pathways
Lipoic acid metabolismPW002499 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Lipoic acid metabolismec00785 Map00785
SMPDB Reactions
Lipoic acid + Adenosine triphosphatePyrophosphate + lipoyl-AMP
lipoyl-AMP + apoprotein → Protein N6-(lipoyl)lysine + Adenosine monophosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00239lipoyl-AMPShow
YMDB00334Lipoic acidShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
Process
macromolecule modification
protein modification process
post-translational protein modification
protein-cofactor linkage
protein lipoylation
metabolic process
macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL046W
Gene Sequence>YJL046W AIM22 SGDID:S000003582, Chr X from 352386-353615, Verified ORF, "Putative lipoate-protein ligase, required along with Lip2 and Lip5 for lipoylation of Lat1p and Kgd2p; similar to E. coli LplA; null mutant displays reduced frequency of mitochondria ATGTCTATGATGCTAAGTAATTGGGCACTCTCCCCTCGATATGTGGGACAGCGAAACCTC ATACATTGCACCACTTTATTTCACACACTTACACGATGGGCAAAAGACGCAGACGATAAA TATCATGATATAAACTCAATGTATGAAAACATGTTTACACCTTCAAATGATAACGTTTCA ATTTTGCAGGATGAAGGTAAATCTGATTATGATACGACGAAGGCCAGCTCTATGGAAGAA GATATCAGTGCTTTTAATAAAGACTTGTACAATTTCTATAATATTGGATATGCCAAACAG ATCATGTCTGCTTCACAATTGGAAAATATAGTAAAGGCAAAGGGCAGATTTGTTATACAA AGTTTATCCACCAGTCCTTATTATAATTTGGCCCTTGAAAACTATGTTTTCAAGAATACA CCAAGAGCCAAAAGAGGTCCCGATAATTGCAGACTGTTATTTTACATCAATGATAGGTGC GCCGTTATAGGCAAAAACCAAAATCTGTGGCAGGAAGTAGATCTTGCTAAGCTGAAGAGT AAGAATTTCGAACTACTTAGAAGATTTTCTGGAGGTGGCACTGTACTGCATGATTTGGGC AATGTTAATTATTCATATTTAACATCAAGGGAGAAATTCGAAACAAAGTTTTTCAACAAA ATGATAATTAAGTGGTTAAATTCATTGAATCCCGAACTAAGACTAGATTTGAATGAGAGA GGAGATATTATTCAGGACGGGTTTAAAATTAGTGGCAGTGCTTATAAAATTGCCGGTGGC AAAGCATACCATCATGCAACGATGTTGCTTAATGCGGATTTAGAACAGTTTAGCGGCTTA TTAGAACCCTCACTACCGAACAATATGGAATGGGAGTCAAGTGGAGTTCATAGTGTAAAA TCAAAAATCAAAAATGTTGGTATAATTACTCCTAATCAGTTCATTGCAGTGGTATCCGAG CGTTTTCAGAAAACATTCAAAGTTGACGGCGAAATACCTATATATTACTGTGACGAGTTT AAATCTATAAACGATGAGATTAAAGATGCTATGAACACCTTACAGAGCGAACAATGGAAA TATTTCTCGGGGCCTAAATTTTCAGTGAAGATTAAAGATAAAGGCTTAACAATTAAAGTC GAAAAGGGCATGATTTATGATTGTGATAGAAATGATTTAATCGGCTTGGAATTCAAAGGA TTTTTGGAGAATATTGACAGTTACACATAA
Protein Properties
Pfam Domain Function
Protein Residues409
Protein Molecular Weight47003.0
Protein Theoretical pI7.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative lipoate-protein ligase A MSMMLSNWALSPRYVGQRNLIHCTTLFHTLTRWAKDADDKYHDINSMYENMFTPSNDNVS ILQDEGKSDYDTTKASSMEEDISAFNKDLYNFYNIGYAKQIMSASQLENIVKAKGRFVIQ SLSTSPYYNLALENYVFKNTPRAKRGPDNCRLLFYINDRCAVIGKNQNLWQEVDLAKLKS KNFELLRRFSGGGTVLHDLGNVNYSYLTSREKFETKFFNKMIIKWLNSLNPELRLDLNER GDIIQDGFKISGSAYKIAGGKAYHHATMLLNADLEQFSGLLEPSLPNNMEWESSGVHSVK SKIKNVGIITPNQFIAVVSERFQKTFKVDGEIPIYYCDEFKSINDEIKDAMNTLQSEQWK YFSGPKFSVKIKDKGLTIKVEKGMIYDCDRNDLIGLEFKGFLENIDSYT
References
External Links
ResourceLink
Saccharomyces Genome Database AIM22
Uniprot IDP47051
Uniprot NameLPLA_YEAST
General Reference
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Zhang, Z., Dietrich, F. S. (2005). "Mapping of transcription start sites in Saccharomyces cerevisiae using 5' SAGE." Nucleic Acids Res 33:2838-2851.15905473