You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGPI-anchored wall transfer protein 1
SynonymsNot Available
Gene NameGWT1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups
Specific FunctionProbable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI- anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Palmityl-CoA + 6-(alpha-D-glucosaminyl)-1-phosphatidyl-1D-myo-inositol ↔ 6-(alpha-D-glucosaminyl)-O-acyl-1-phosphatidyl-1D-myo-inositol + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00527palmitoyl-CoAShow
GO Classification
Component
organelle membrane
endoplasmic reticulum membrane
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring acyl groups
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid lipidation
GPI anchor biosynthetic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL091C
Gene Sequence>1497 bp ATGGCAACAGTACATCAGAAGAATATGTCGACTTTAAAACAGAGAAAAGAGGACTTTGTG ACAGGGCTCAATGGCGGTTCTATAACAGAAATTAACGCAGTGACATCAATTGCTTTGGTA ACTTACATATCATGGAACTTATTGAAAAATTCCAACCTTATGCCTCCTGGCATTTCCAGC GTGCAATACATAATTGATTTTGCATTGAACTGGGTTGCTTTGCTTCTATCTATTACTATT TATGCTAGTGAACCATACCTTCTAAACACGCTAATACTGTTACCTTGTTTGCTCGCATTC ATATATGGAAAATTTACTAGCTCGAGTAAACCTTCTAATCCAATATACAATAAAAAAAAA ATGATTACACAGCGGTTCCAACTAGAAAAAAAGCCGTATATTACTGCGTATCGTGGTGGG ATGCTTATTCTGACTGCTATTGCCATCTTGGCTGTAGATTTTCCAATTTTCCCAAGGAGG TTTGCCAAGGTGGAAACTTGGGGGACATCCCTGATGGATCTTGGTGTAGGATCATTCGTT TTCAGTAACGGTATTGTTTCTTCTAGGGCACTGTTGAAAAACCTAAGCTTGAAGAGTAAA CCCAGCTTCTTAAAAAATGCATTTAATGCCTTAAAATCAGGAGGAACTCTATTGTTCCTA GGATTGCTGAGGTTGTTTTTTGTAAAAAATTTGGAATATCAAGAACATGTCACAGAATAT GGGGTTCATTGGAATTTTTTTATCACCCTATCATTGTTGCCACTTGTATTGACCTTTATT GATCCCGTCACAAGAATGGTTCCACGCTGCTCAATTGCAATATTCATTTCATGCATTTAT GAATGGCTACTTTTAAAGGACGATCGCACTTTAAACTTTTTAATTTTGGCTGATAGAAAT TGTTTCTTCAGTGCTAATAGAGAAGGCATCTTCTCATTTCTAGGTTATTGCTCGATTTTT CTTTGGGGCCAAAACACGGGATTTTACTTGTTGGGAAATAAACCAACTTTAAACAATCTT TATAAGCCTTCTACGCAAGACGTAGTTGCAGCATCAAAGAAGTCTTCGACTTGGGACTAT TGGACTTCAGTAACCCCATTAAGTGGCCTCTGTATATGGAGTACAATTTTTCTTGTTATC AGCCAGTTGGTTTTTCAATACCATCCTTATAGTGTTTCAAGAAGGTTTGCTAACTTACCA TATACTTTGTGGGTCATTACTTATAATTTACTATTTTTGACTGGGTACTGCTTGACTGAC AAAATTTTCGGTAATTCTTCGGAATATTATAAAGTTGCCGAATGCTTGGAATCAATCAAC TCCAATGGGTTGTTTTTATTTTTGTTGGCAAATGTCTCTACTGGTTTAGTCAATATGTCT ATGGTCACGATAGATTCTTCACCCTTAAAATCATTCCTGGTTTTGTTGGCATACTGCTCA TTCATAGCTGTCATATCGGTTTTCTTGTATAGAAAAAGAATATTCATTAAGCTATAA
Protein Properties
Pfam Domain Function
Protein Residues490
Protein Molecular Weight55465.60156
Protein Theoretical pI9.69
Signalling Regions
  • None
Transmembrane Regions
  • 20-40
  • 55-75
  • 77-97
  • 129-149
  • 158-178
  • 200-220
  • 232-252
  • 258-278
  • 302-322
  • 357-377
  • 391-411
  • 436-456
  • 461-481
Protein Sequence>GPI-anchored wall transfer protein 1 MSTLKQRKEDFVTGLNGGSITEINAVTSIALVTYISWNLLKNSNLMPPGISSVQYIIDFA LNWVALLLSITIYASEPYLLNTLILLPCLLAFIYGKFTSSSKPSNPIYNKKKMITQRFQL EKKPYITAYRGGMLILTAIAILAVDFPIFPRRFAKVETWGTSLMDLGVGSFVFSNGIVSS RALLKNLSLKSKPSFLKNAFNALKSGGTLLFLGLLRLFFVKNLEYQEHVTEYGVHWNFFI TLSLLPLVLTFIDPVTRMVPRCSIAIFISCIYEWLLLKDDRTLNFLILADRNCFFSANRE GIFSFLGYCSIFLWGQNTGFYLLGNKPTLNNLYKPSTQDVVAASKKSSTWDYWTSVTPLS GLCIWSTIFLVISQLVFQYHPYSVSRRFANLPYTLWVITYNLLFLTGYCLTDKIFGNSSE YYKVAECLESINSNGLFLFLLANVSTGLVNMSMVTIDSSPLKSFLVLLAYCSFIAVISVF LYRKRIFIKL
References
External Links
ResourceLink
Saccharomyces Genome Database GWT1
Uniprot IDP47026
Uniprot NameGWT1_YEAST
GenBank Gene IDZ49366
Genebank Protein ID1008262
General Reference
  • Miosga, T., Schaaff-Gerstenschlager, I., Chalwatzis, N., Baur, A., Boles, E., Fournier, C., Schmitt, S., Velten, C., Wilhelm, N., Zimmermann, F. K. (1995). "Sequence analysis of a 33.1 kb fragment from the left arm of Saccharomyces cerevisiae chromosome X, including putative proteins with leucine zippers, a fungal Zn(II)2-Cys6 binuclear cluster domain and a putative alpha 2-SCB-alpha 2 binding site." Yeast 11:681-689.7483841
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Umemura, M., Okamoto, M., Nakayama, K., Sagane, K., Tsukahara, K., Hata, K., Jigami, Y. (2003). "GWT1 gene is required for inositol acylation of glycosylphosphatidylinositol anchors in yeast." J Biol Chem 278:23639-23647.12714589
  • Tsukahara, K., Hata, K., Nakamoto, K., Sagane, K., Watanabe, N. A., Kuromitsu, J., Kai, J., Tsuchiya, M., Ohba, F., Jigami, Y., Yoshimatsu, K., Nagasu, T. (2003). "Medicinal genetics approach towards identifying the molecular target of a novel inhibitor of fungal cell wall assembly." Mol Microbiol 48:1029-1042.12753194
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Okamoto, M., Yoko-o, T., Umemura, M., Nakayama, K., Jigami, Y. (2006). "Glycosylphosphatidylinositol-anchored proteins are required for the transport of detergent-resistant microdomain-associated membrane proteins Tat2p and Fur4p." J Biol Chem 281:4013-4023.16361252
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258