Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycogenin-2
Synonyms
  • Glycogen synthesis initiator protein 2
  • Glycogenin glucosyltransferase 2
Gene NameGLG2
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring glycosyl groups
Specific FunctionSelf-glucosylating initiator of glycogen synthesis. Catalyzes the formation of a short alpha (1,4)-glucosyl chain covalently attached via a glucose 1-O-tyrosyl linkage to internal tyrosine residues. These chains act as primers for the elongation reaction catalyzed by glycogen synthase. Capable of transferring glucosyl residues to unbound acceptors such as free oligoglucans or oligoglucan derivatives
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
Not Available
Gene Properties
Chromosome Locationchromosome 10
LocusYJL137C
Gene Sequence>1143 bp ATGGCCAAGAAAGTTGCCATCTGTACATTGCTGTATTCACGGGACTATTTACCTGGCGCA TTGACTTTAGCGTACCAATTACAAAAACTCTTGAAACACGCTGTAGTGGAAGATGAGATA ACCTTATGCCTGCTAATTGAAAAAAAATTGTTTGGAGATGAGTTTAAACCTCAGGAAATA GCTTTAATTAGAAGTCTTTTTAAAGAGATTATCATTATTGAACCGCTAAAGGATCAAGAG AAGAGCATAGAGAAGAATAAGGCAAATCTTGAACTGTTGAAAAGGCCTGAGCTATCTCAT ACTTTACTCAAGGCTAGACTGTGGGAACTGGTGCAGTTCGATCAGGTTTTATTTTTAGAT GCTGATACTTTACCATTAAATAAAGAATTTTTTGAAATCCTACGATTATACCCTGAACAA ACAAGATTCCAGATTGCTGCGGTTCCAGACATCGGATGGCCTGACATGTTCAACACCGGT GTACTACTACTAATTCCTGATTTAGATATGGCAACAAGTTTACAAGATTTTTTGATTAAA ACTGTATCGATTGATGGTGCTGATCAAGGAATCTTCAATCAATTTTTTAATCCTATTTGC AACTACAGCAAAGAGGTTTTGCATAAGGTGTCTCCACTCATGGAATGGATACGCCTCCCC TTCACCTACAACGTAACCATGCCCAACTACGGATACCAGTCTTCACCAGCCATGAATTTT TTCCAACAACACATCAGACTTATTCACTTCATTGGAACGTTTAAGCCATGGTCCCGTAAT ACAACTGACTATGACGACCACTATTACCAGCTGTGGAGAAGTACACAGCGTGAACTTTAT AGTGAATGCCACTTAAGTAACTACTTCACACACTTGCAATTGGGCAATATTGAAACAGAG ACAAATTTTTACCACGAACCTCCTTGTCTTCAAGACCTGTTGAATCATGGTAAAAGAGAA AATCAAAAGCACGTTGACCTGGATATAACCTCAGTAGATCGAAATGCTTCGCAGAAGAGT ACTGCAGAGAAACATGATATTGAGAAACCGACATCTAAGCCGCAATCTGCTTTTAAATTT GATTGGGAGTCTACGGATTATTTAGACCGCGTCCAAAGAGCATTCCCAAAGCCTGATACC TGA
Protein Properties
Pfam Domain Function
Protein Residues380
Protein Molecular Weight44545.60156
Protein Theoretical pI5.94
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycogenin-2 MAKKVAICTLLYSRDYLPGALTLAYQLQKLLKHAVVEDEITLCLLIEKKLFGDEFKPQEI ALIRSLFKEIIIIEPLKDQEKSIEKNKANLELLKRPELSHTLLKARLWELVQFDQVLFLD ADTLPLNKEFFEILRLYPEQTRFQIAAVPDIGWPDMFNTGVLLLIPDLDMATSLQDFLIK TVSIDGADQGIFNQFFNPICNYSKEVLHKVSPLMEWIRLPFTYNVTMPNYGYQSSPAMNF FQQHIRLIHFIGTFKPWSRNTTDYDDHYYQLWRSTQRELYSECHLSNYFTHLQLGNIETE TNFYHEPPCLQDLLNHGKRENQKHVDLDITSVDRNASQKSTAEKHDIEKPTSKPQSAFKF DWESTDYLDRVQRAFPKPDT
References
External Links
ResourceLink
Saccharomyces Genome Database GLG2
Uniprot IDP47011
Uniprot NameGLG2_YEAST
GenBank Gene IDU25436
Genebank Protein ID1217991
General Reference
  • Cheng, C., Mu, J., Farkas, I., Huang, D., Goebl, M. G., Roach, P. J. (1995). "Requirement of the self-glucosylating initiator proteins Glg1p and Glg2p for glycogen accumulation in Saccharomyces cerevisiae." Mol Cell Biol 15:6632-6640.8524228
  • Katsoulou, C., Tzermia, M., Tavernarakis, N., Alexandraki, D. (1996). "Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI." Yeast 12:787-797.8813765
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Mu, J., Cheng, C., Roach, P. J. (1996). "Initiation of glycogen synthesis in yeast. Requirement of multiple tyrosine residues for function of the self-glucosylating Glg proteins in vivo." J Biol Chem 271:26554-26560.8900126
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albrecht, T., Haebel, S., Koch, A., Krause, U., Eckermann, N., Steup, M. (2004). "Yeast glycogenin (Glg2p) produced in Escherichia coli is simultaneously glucosylated at two vicinal tyrosine residues but results in a reduced bacterial glycogen accumulation." Eur J Biochem 271:3978-3989.15479227