You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibulose-phosphate 3-epimerase
Synonyms
  • Pentose-5-phosphate 3-epimerase
  • PPE
  • RPE
Gene NameRPE1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInvolved in the protective response to oxidative stress
Cellular LocationCytoplasm
SMPDB Pathways
RiboneogenesisPW002511 ThumbThumb?image type=greyscaleThumb?image type=simple
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose and glucuronate interconversionsec00040 Map00040
Pentose phosphate pathwayec00030 Map00030
SMPDB Reactions
Xylulose 5-phosphate → L-ribulose 5-phosphate
Xylulose 5-phosphateD-ribulose 5-phosphate
Xylulose 5-phosphateD-ribulose 5-phosphate
KEGG Reactions
D-ribulose 5-phosphateXylulose 5-phosphate
Metabolites
YMDB IDNameView
YMDB00362Xylulose 5-phosphateShow
YMDB00948D-ribulose 5-phosphateShow
GO Classification
Component
Not Available
Function
racemase and epimerase activity
racemase and epimerase activity, acting on carbohydrates and derivatives
ribulose-phosphate 3-epimerase activity
catalytic activity
isomerase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL121C
Gene Sequence>717 bp ATGGTCAAACCAATTATAGCTCCCAGTATCCTTGCTTCTGACTTCGCCAACTTGGGTTGC GAATGTCATAAGGTCATCAACGCCGGCGCAGATTGGTTACATATCGATGTCATGGACGGC CATTTTGTTCCAAACATTACTCTGGGCCAACCAATTGTTACCTCCCTACGTCGTTCTGTG CCACGCCCTGGCGATGCTAGCAACACAGAAAAGAAGCCCACTGCGTTCTTCGATTGTCAC ATGATGGTTGAAAATCCTGAAAAATGGGTCGACGATTTTGCTAAATGTGGTGCTGACCAA TTTACGTTCCACTACGAGGCCACACAAGACCCTTTGCATTTAGTTAAGTTGATTAAGTCT AAGGGCATCAAAGCTGCATGCGCCATCAAACCTGGTACTTCTGTTGACGTTTTATTTGAA CTAGCTCCTCATTTGGATATGGCTCTTGTTATGACTGTGGAACCTGGGTTTGGAGGCCAA AAATTCATGGAAGACATGATGCCAAAAGTGGAAACTTTGAGAGCCAAGTTCCCCCATTTG AATATCCAAGTCGATGGTGGTTTGGGCAAGGAGACCATCCCGAAAGCCGCCAAAGCCGGT GCCAACGTTATTGTCGCTGGTACCAGTGTTTTCACTGCAGCTGACCCGCACGATGTTATC TCCTTCATGAAAGAAGAAGTCTCGAAGGAATTGCGTTCTAGAGATTTGCTAGATTAG
Protein Properties
Pfam Domain Function
Protein Residues238
Protein Molecular Weight25966.90039
Protein Theoretical pI6.23
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribulose-phosphate 3-epimerase MVKPIIAPSILASDFANLGCECHKVINAGADWLHIDVMDGHFVPNITLGQPIVTSLRRSV PRPGDASNTEKKPTAFFDCHMMVENPEKWVDDFAKCGADQFTFHYEATQDPLHLVKLIKS KGIKAACAIKPGTSVDVLFELAPHLDMALVMTVEPGFGGQKFMEDMMPKVETLRAKFPHL NIQVDGGLGKETIPKAAKAGANVIVAGTSVFTAADPHDVISFMKEEVSKELRSRDLLD
References
External Links
ResourceLink
Saccharomyces Genome Database RPE1
Uniprot IDP46969
Uniprot NameRPE_YEAST
GenBank Gene IDAY557858
Genebank Protein ID45269607
General Reference
  • Miosga, T., Zimmermann, F. K. (1996). "Cloning and characterization of the first two genes of the non-oxidative part of the Saccharomyces cerevisiae pentose-phosphate pathway." Curr Genet 30:404-409.8929392
  • Juhnke, H., Krems, B., Kotter, P., Entian, K. D. (1996). "Mutants that show increased sensitivity to hydrogen peroxide reveal an important role for the pentose phosphate pathway in protection of yeast against oxidative stress." Mol Gen Genet 252:456-464.8879247
  • Cziepluch, C., Kordes, E., Pujol, A., Jauniaux, J. C. (1996). "Sequencing analysis of a 40.2 kb fragment of yeast chromosome X reveals 19 open reading frames including URA2 (5' end), TRK1, PBS2, SPT10, GCD14, RPE1, PHO86, NCA3, ASF1, CCT7, GZF3, two tRNA genes, three remnant delta elements and a Ty4 transposon." Yeast 12:1471-1474.8948101
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956