You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit
SynonymsNot Available
Gene NameGPI2
Enzyme Class
Biological Properties
General FunctionInvolved in phosphatidylinositol N-acetylglucosaminyltransferase activity
Specific FunctionPart of the complex catalyzing the transfer of N- acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG Pathways
Glycosylphosphatidylinositol(GPI)-anchor biosynthesisec00563 Map00563
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
UDP-glycosyltransferase activity
acetylglucosaminyltransferase activity
phosphatidylinositol N-acetylglucosaminyltransferase activity
Process
metabolic process
macromolecule metabolic process
macromolecule modification
protein modification process
protein amino acid lipidation
GPI anchor biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL076W
Gene Sequence>843 bp ATGACAAGATCTCCCTGGAAGCGCCTACTATGGTTGAAACAGGAGTACCCAGATAATTAT ACAGATCCAAGTTTTATTGAGTTGAGAGCAAGACAAAAGGCTGAGAGTAACCAGAAGTCT GATAGAAAATTATCAGAAGCTGCTCGCGCTCAAATTAGGTTGGATTTTATAAGTTTCTAC CAAACCATATTGAACACTTCTTTCATTTACATCACTTTTACATATATTTACTATTATGGC TTCGATCCTATTCCGCCAACTATTTTCCTTTCATTTATAACATTGATTATATCAAGGACG AAAGTCGACCCTCTATTGTCCTCATTCATGGACGTAAAGTCTTCGCTGATTATCACATTT GCAATGTTGACTCTCTCTCCAGTCCTCAAATCTCTTTCTAAAACAACTGCATCTGATTCC ATATGGACATTGTCTTTTTGGCTGACCCTATGGTACATTTTCGTTATTTCGTCAACAAAG TCCAAAGATAAACCCTCTAACCTTTCCACCAATATACTTGTCGCCCTTGTTGCTGTCCTA TCATCGAGGCTTTCGACCACGATCGACGTATTCTGTTTTCTTTTAATTTGTATTCAGTTG AATATCATTCTACCCACTTATTTATCGGTGACGAATAAGGTAGTACCAATAATTTCAAAT ATTATTGTATACTCATTTTTGAATGTTGCTCTAGGTTGGATTTATATGCTGTTGATTTTC TTTGCTTCAGTATTTTATATTACTGTTTTACCTAAGTGGTTCATCTACTGGAAAATCAAT TATCATAAACGGGATAACGATCTACTAAGTACATGGGATGCAAGAACACCAATATTGGAT TAG
Protein Properties
Pfam Domain Function
Protein Residues280
Protein Molecular Weight32576.80078
Protein Theoretical pI9.77
Signalling Regions
  • None
Transmembrane Regions
  • 54-74
  • 76-96
  • 109-129
  • 136-156
  • 190-210
  • 221-241
Protein Sequence>Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit MTRSPWKRLLWLKQEYPDNYTDPSFIELRARQKAESNQKSDRKLSEAARAQIRLDFISFY QTILNTSFIYITFTYIYYYGFDPIPPTIFLSFITLIISRTKVDPLLSSFMDVKSSLIITF AMLTLSPVLKSLSKTTASDSIWTLSFWLTLWYIFVISSTKSKDKPSNLSTNILVALVAVL SSRLSTTIDVFCFLLICIQLNIILPTYLSVTNKVVPIISNIIVYSFLNVALGWIYMLLIF FASVFYITVLPKWFIYWKINYHKRDNDLLSTWDARTPILD
References
External Links
ResourceLink
Saccharomyces Genome Database GPI2
Uniprot IDP46961
Uniprot NameGPI2_YEAST
GenBank Gene IDAY692961
Genebank Protein ID51013373
General Reference
  • Leidich, S. D., Kostova, Z., Latek, R. R., Costello, L. C., Drapp, D. A., Gray, W., Fassler, J. S., Orlean, P. (1995). "Temperature-sensitive yeast GPI anchoring mutants gpi2 and gpi3 are defective in the synthesis of N-acetylglucosaminyl phosphatidylinositol. Cloning of the GPI2 gene." J Biol Chem 270:13029-13035.7768896
  • Uemura, H., Jigami, Y. (1995). "A new essential gene GCR4 located in the upstream region of GCR1." Yeast 11:1093-1101.7502585
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Sobering, A. K., Watanabe, R., Romeo, M. J., Yan, B. C., Specht, C. A., Orlean, P., Riezman, H., Levin, D. E. (2004). "Yeast Ras regulates the complex that catalyzes the first step in GPI-anchor biosynthesis at the ER." Cell 117:637-648.15163411
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258