You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NametRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61
Synonyms
  • General control non-derepressible protein 14
  • Protein GCD14
  • tRNA(m1A58)-methyltransferase subunit TRM61
  • tRNA(m1A58)MTase subunit TRM61
Gene NameGCD14
Enzyme Class
Biological Properties
General FunctionInvolved in tRNA (adenine-N1-)-methyltransferase activity
Specific FunctionCatalytic subunit of tRNA (adenine-N(1)-)- methyltransferase, which catalyzes the formation of N(1)- methyladenine at position 58 (m1A58) in initiator methionyl-tRNA. GCD14 is also required for repression of GCN4 mRNA translation by the upstream open reading frames (uORFs) under conditions of amino acid sufficiency
Cellular LocationNucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
GO Classification
Component
Not Available
Function
RNA methyltransferase activity
tRNA methyltransferase activity
tRNA (adenine) methyltransferase activity
tRNA (adenine-N1-)-methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
Process
RNA metabolic process
RNA modification
RNA methylation
tRNA methylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL125C
Gene Sequence>1152 bp ATGTCAACAAATTGTTTTTCCGGTTACAAAGACCTCATCAAGGAAGGCGATTTAACTCTA ATATGGGTTTCTAGAGATAACATCAAACCGGTAAGGATGCATTCCGAAGAGGTATTCAAT ACTCGTTATGGTTCATTTCCTCATAAGGATATCATAGGTAAACCTTATGGTTCTCAAATT GCTATAAGAACAAAGGGCTCAAATAAGTTTGCATTCGTCCATGTTCTGCAACCAACTCCT GAATTGTGGACTTTGTCGTTACCACACAGAACTCAAATTGTATATACGCCCGACTCTTCC TACATCATGCAAAGGTTGAATTGTAGCCCTCACAGCAGAGTGATCGAGGCAGGTACAGGC TCAGGATCATTTTCGCACGCTTTTGCAAGATCTGTAGGTCATCTTTTTAGTTTTGAATTT CATCACATAAGATACGAACAAGCATTAGAGGAATTCAAAGAGCATGGACTTATTGATGAT AACGTTACGATTACACATCGGGATGTTTGCCAAGGTGGATTTCTTATAAAGAAGGGAGAC ACTACATCTTACGAATTTGGCAATAATGAAACCGCCGCTTCATTGAATGCAAATGTAGTG TTTTTAGATCTGCCGGCTCCCTGGGATGCTATACCTCATCTGGATTCTGTTATTTCCGTA GACGAAAAGGTCGGATTGTGTTGCTTCTCCCCATGCATTGAGCAAGTAGACAAAACATTG GATGTATTAGAGAAATATGGCTGGACGGATGTTGAAATGGTGGAAATTCAAGGTAGACAG TACGAAAGTCGAAGACAAATGGTCAGATCACTCAATGATGCCCTGGAAAGGTTGAGAGAT ATTAAGAGGCACAAACTCCAGGGTGTAGAAAGACGCAAGCGGATGTTTAACAATACAATA GATTCTAACGATGAAAAAGTTGGAAAAAGAAACGAGGATGGCGTACCATTAACAGAAAAG GCCAAATTTAATCCTTTTGGCAAAGGTTCTCGAATCAAGGAAGGTGATAGTAATTATAAA TGGAAGGAGGTCACAAAGATGGAAGCTGAGATCAAATCCCATACCTCATATTTGACTTTT GCATTTAAAGTTGTGAATAGATCAAGAGATGATGAAAAAGTTAACGAAATTCTTCGATCC ACGGAAAAATAA
Protein Properties
Pfam Domain Function
Protein Residues383
Protein Molecular Weight43919.30078
Protein Theoretical pI7.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>tRNA (adenine-N(1)-)-methyltransferase catalytic subunit TRM61 MSTNCFSGYKDLIKEGDLTLIWVSRDNIKPVRMHSEEVFNTRYGSFPHKDIIGKPYGSQI AIRTKGSNKFAFVHVLQPTPELWTLSLPHRTQIVYTPDSSYIMQRLNCSPHSRVIEAGTG SGSFSHAFARSVGHLFSFEFHHIRYEQALEEFKEHGLIDDNVTITHRDVCQGGFLIKKGD TTSYEFGNNETAASLNANVVFLDLPAPWDAIPHLDSVISVDEKVGLCCFSPCIEQVDKTL DVLEKYGWTDVEMVEIQGRQYESRRQMVRSLNDALERLRDIKRHKLQGVERRKRMFNNTI DSNDEKVGKRNEDGVPLTEKAKFNPFGKGSRIKEGDSNYKWKEVTKMEAEIKSHTSYLTF AFKVVNRSRDDEKVNEILRSTEK
References
External Links
ResourceLink
Saccharomyces Genome Database GCD14
Uniprot IDP46959
Uniprot NameTRM61_YEAST
GenBank Gene IDZ49400
Genebank Protein ID1008322
General Reference
  • Cziepluch, C., Kordes, E., Pujol, A., Jauniaux, J. C. (1996). "Sequencing analysis of a 40.2 kb fragment of yeast chromosome X reveals 19 open reading frames including URA2 (5' end), TRK1, PBS2, SPT10, GCD14, RPE1, PHO86, NCA3, ASF1, CCT7, GZF3, two tRNA genes, three remnant delta elements and a Ty4 transposon." Yeast 12:1471-1474.8948101
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Anderson, J., Phan, L., Cuesta, R., Carlson, B. A., Pak, M., Asano, K., Bjork, G. R., Tamame, M., Hinnebusch, A. G. (1998). "The essential Gcd10p-Gcd14p nuclear complex is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA." Genes Dev 12:3650-3662.9851972
  • Cuesta, R., Hinnebusch, A. G., Tamame, M. (1998). "Identification of GCD14 and GCD15, novel genes required for translational repression of GCN4 mRNA in Saccharomyces cerevisiae." Genetics 148:1007-1020.9539420
  • Anderson, J., Phan, L., Hinnebusch, A. G. (2000). "The Gcd10p/Gcd14p complex is the essential two-subunit tRNA(1-methyladenosine) methyltransferase of Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 97:5173-5178.10779558
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956