You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameD-lactate dehydrogenase [cytochrome] 2, mitochondrial
Synonyms
  • Actin-interacting protein 2
  • D-lactate ferricytochrome C oxidoreductase
  • D-LCR
Gene NameDLD2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionIn addition to its enzymatic role it could play an important role in the yeast cell morphology
Cellular LocationMitochondrion matrix
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
D-Lactic acid + ferricytochrome cPyruvic acid + Pentane + hydron
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00175Pyruvic acidShow
YMDB00287D-Lactic acidShow
YMDB00862hydronShow
YMDB16246PentaneShow
YMDB16255ferricytochrome cShow
GO Classification
Component
Not Available
Function
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDL178W
Gene Sequence>1593 bp ATGCTAAGAAACATTTTGGTGAGAAGTACTGGCAGCAATTTCAAATTTGCTGGCAGATAT ATGAAATCATCAGCTCTTTTAGGATACTATAGAAGAGTTAACTATTATTCGACCAAGATA CAAACCAGACTGACTAGCGAAAACTATCCAGACGTGCATCGAGACCCTAGATTCAAAAAA TTAACGTCCGATGATCTAAATTATTTTAAATCTATTTTATCGGAACAAGAAATATTAAGA GCCAGCGAATCAGAGGATCTTTCATTTTATAATGAAGATTGGATGAGAAAGTACAAAGGA CAGTCCAAGTTAGTATTGAGACCTAAGTCAGTGGAAAAAGTTTCTTTAATCTTAAATTAT TGTAATGATGAAAAAATTGCCGTTGTCCCACAAGGCGGTAACACGGGGTTGGTAGGTGGT TCTGTGCCCATTTTTGATGAATTAATTCTATCTTTAGCAAATTTAAACAAAATAAGAGAT TTTGACCCTGTATCAGGTATCTTGAAGTGTGATGCTGGTGTAATCTTGGAAAATGCTAAC AATTACGTAATGGAACAAAATTATATGTTTCCGTTGGATCTGGGAGCTAAAGGTTCCTGC CATGTTGGTGGCGTGGTTGCAACCAACGCTGGAGGACTAAGGTTATTGCGTTATGGCTCA CTACATGGAAGCGTTTTAGGCCTAGAGGTGGTAATGCCCAATGGTCAAATTGTTAGTAGC ATGCATTCCATGAGAAAAGACAACACCGGTTATGATCTGAAACAGCTGTTCATTGGCTCA GAAGGTACTATCGGTATCATCACTGGTGTTTCAATCTTGACTGTTCCTAAGCCAAAAGCG TTTAATGTATCTTACTTGTCTGTTGAAAGTTTTGAAGACGTTCAAAAAGTCTTCGTCAGA GCCAGGCAAGAATTATCTGAGATTTTATCCGCTTTTGAATTTATGGATGCTAAATCTCAA GTATTGGCCAAGAGCCAATTGAAGGATGCTGCCTTCCCTTTGGAGGATGAGCATCCATTT TATATTCTTATCGAAACGTCAGGGTCAAACAAAGATCACGATGATTCCAAACTTGAAACA TTTTTAGAAAACGTCATGGAAGAGGGCATAGTAACGGATGGTGTAGTGGCACAAGATGAA ACCGAACTCCAAAACTTGTGGAAGTGGAGAGAAATGATTCCAGAGGCAAGTCAAGCTAAT GGTGGTGTTTACAAATACGATGTTTCTTTACCACTAAAGGACCTATATTCTTTGGTTGAA GCCACTAATGCAAGACTTTCTGAAGCTGAATTAGTGGGTGATTCGCCCAAACCAGTGGTG GGCGCCATTGGATACGGTCACGTGGGTGATGGTAATCTACACTTAAATGTTGCAGTTAGA GAGTACAACAAGAACATTGAAAAGACTTTGGAACCATTTGTCTACGAGTTTGTTTCCTCA AAACATGGTTCCGTTAGTGCCGAACATGGGCTAGGTTTCCAAAAGAAAAATTACATTGGC TATTCTAAGAGCCCGGAAGAGGTCAAGATGATGAAGGATTTGAAGGTTCATTATGATCCT AATGGAATTTTAAACCCTTACAAATACATTTGA
Protein Properties
Pfam Domain Function
Protein Residues530
Protein Molecular Weight59268.0
Protein Theoretical pI6.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>D-lactate dehydrogenase [cytochrome] 2, mitochondrial MLRNILVRSTGSNFKFAGRYMKSSALLGYYRRVNYYSTKIQTRLTSENYPDVHRDPRFKK LTSDDLNYFKSILSEQEILRASESEDLSFYNEDWMRKYKGQSKLVLRPKSVEKVSLILNY CNDEKIAVVPQGGNTGLVGGSVPIFDELILSLANLNKIRDFDPVSGILKCDAGVILENAN NYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLHGSVLGLEVVMPNGQIVNS MHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFNVSYLSVESFEDVQKVFVR ARQELSEILSAFEFMDAKSQVLAKSQLKDAAFPLEDEHPFYILIETSGSNKDHDDSKLET FLENVMEEGIVTDGVVAQDETELQNLWKWREMIPEASQANGGVYKYDVSLPLKDLYSLVE ATNARLSEAELVGDSPKPVVGAIGYGHVGDGNLHLNVAVREYNKNIEKTLEPFVYEFVSS KHGSVSAEHGLGFQKKNYIGYSKSPEEVKMMKDLKVHYDPNGILNPYKYI
References
External Links
ResourceLink
Saccharomyces Genome Database DLD2
Uniprot IDP46681
Uniprot NameDLD2_YEAST
GenBank Gene IDAY723765
Genebank Protein ID51830216
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Chelstowska, A., Liu, Z., Jia, Y., Amberg, D., Butow, R. A. (1999). "Signalling between mitochondria and the nucleus regulates the expression of a new D-lactate dehydrogenase activity in yeast." Yeast 15:1377-1391.10509019
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hachiya, N. S., Sakasegawa, Y., Jozuka, A., Tsukita, S., Kaneko, K. (2004). "Interaction of D-lactate dehydrogenase protein 2 (Dld2p) with F-actin: implication for an alternative function of Dld2p." Biochem Biophys Res Commun 319:78-82.15158445