You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMethylenetetrahydrofolate reductase 1
SynonymsNot Available
Gene NameMET12
Enzyme Class
Biological Properties
General FunctionInvolved in methylenetetrahydrofolate reductase (NADPH) activity
Specific Function5-methyltetrahydrofolate + NAD(P)(+) = 5,10- methylenetetrahydrofolate + NAD(P)H
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Methane metabolismec00680 Map00680
One carbon pool by folateec00670 Map00670
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB002385-Methyltetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH group of donors
oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
catalytic activity
methylenetetrahydrofolate reductase (NADPH) activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
oxidation reduction
sulfur amino acid metabolic process
metabolic process
methionine metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL023C
Gene Sequence>1974 bp ATGTCCATCAGAGATTTATATCATGCGAGGGCTTCCCCTTTTATATCGTTAGAATTCTTC CCTCCAAAGACTGAATTAGGGACGAGAAATTTGATGGAACGTATGCATCGTATGACTGCT TTAGATCCACTGTTTATCACGGTTACTTGGGGAGCAGGTGGTACTACTGCGGAAAAGACT CTGACATTAGCTTCCTTGGCACAGCAGACACTAAATATACCAGTTTGTATGCATTTGACC TGTACAAACACAGAAAAAGCCATCATTGATGATGCGCTGGATAGATGTTATAATGCAGGA ATCAGGAATATTTTGGCTCTTCGAGGTGACCCACCTATTGGGGAAGATTGGCTAGATTCT CAATCGAACGAATCACCTTTTAAATATGCGGTTGATTTAGTTCGTTATATCAAGCAAAGC TACGGAGACAAGTTCTGCGTCGGTGTTGCAGCATATCCAGAAGGTCATTGTGAAGGTGAA GCAGAAGGTCACGAGCAAGACCCATTGAAGGATTTGGTATATTTAAAAGAAAAAGTTGAA GCTGGGGCCGATTTTGTGATAACACAACTGTTTTACGACGTTGAAAAATTCTTAACTTTT GAAATGCTATTTCGGGAACGGATTTCGCAAGATTTGCCCCTTTTCCCTGGGTTGATGCCT ATTAACTCCTATCTGCTTTTCCACAGAGCAGCAAAGTTATCACATGCATCTATTCCACCT GCAATACTGAGTAGGTTCCCCCCAGAAATCCAATCGGATGATAATGCCGTGAAGTCCATT GGTGTGGACATTCTTATCGAATTGATTCAGGAAATATATCAAAGAACATCTGGTAGAATT AAAGGGTTTCATTTCTATACATTAAATTTGGAAAAGGCTATTGCTCAAATTGTCTCGCAA TCTCCCGTCTTATCCCATATCGTAAATGAATCTAGCGAAGAAGAGGGAGAAGATGAAACC AGTGGCGAAATAGGAAGCATAGAAAATGTGCCAATAGAAGATGCTGACGGGGATATTGTG TTGGATGATTCGAATGAAGAAACTGTAGCAAACCGGAAAAGGAGAAGGCATTCAAGTCTT GATTCGGCCAAGTTGATTTTCAATAGGGCTATCGTCACTGAAAAAGGCTTACGCTATAAT AATGAGAATGGTTCCATGCCATCTAAAAAGGCTTTAATATCTATTTCTAAAGGTCACGGA ACTTTGGGTCGTGATGCCACTTGGGATGAGTTCCCCAATGGTAGATTTGGTGACTCCAGG TCTCCCGCATATGGTGAAATAGACGGTTATGGGCCATCCATCAAGGTAAGCAAAAGCAAA GCGCTTGAACTATGGGGTATACCAAAGACAATTGGCGATTTAAAAGATATTTTTATAAAA TATTTGGAAGGTTCAACGGATGCGATTCCCTGGTCTGACCTGGGTTTATCAGCTGAAACG GCGTTAATACAAGAAGAACTAATCCAACTAAACTATCGCGGATATTTGACTTTGGCATCG CAACCTGCCACAAATGCTACATTGAGTAGTGATAAAATATTCGGCTGGGGGCCCGCGAAA GGGAGGTTGTATCAGAAGGCATTCGTAGAAATGTTTATTCATAGACAGCAATGGGAAACA ACTTTGAAACCCAAGCTAGACCATTACGGGCGTCGGAAATTCAGTTATTACGCGGGCGAT TCATCTGGTTCATTTGAAACGAACCTAGACCCGCACAGCTCTAGCGTTGTAACATGGGGT GTTTTTCCCAACAGTCCGGTCAAACAGACTACAATCATTGAAGAAGAGTCATTCAAGGCA TGGAGAGATGAAGCGTTTAGTATCTGGTCCGAGTGGGCCAAGTTATTTCCAAGGAACACC CCAGCCAATATTCTTCTAAGACTAGTGCATAAAGACTACTGTCTTGTCTCAATTGTTCAT CACGACTTCAAAGAAACCGACGAGCTATGGGAAATGTTACTCGACCAAGCCTAA
Protein Properties
Pfam Domain Function
Protein Residues657
Protein Molecular Weight73940.79688
Protein Theoretical pI5.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Methylenetetrahydrofolate reductase 1 MSIRDLYHARASPFISLEFFPPKTELGTRNLMERMHRMTALDPLFITVTWGAGGTTAEKT LTLASLAQQTLNIPVCMHLTCTNTEKAIIDDALDRCYNAGIRNILALRGDPPIGEDWLDS QSNESPFKYAVDLVRYIKQSYGDKFCVGVAAYPEGHCEGEAEGHEQDPLKDLVYLKEKVE AGADFVITQLFYDVEKFLTFEMLFRERISQDLPLFPGLMPINSYLLFHRAAKLSHASIPP AILSRFPPEIQSDDNAVKSIGVDILIELIQEIYQRTSGRIKGFHFYTLNLEKAIAQIVSQ SPVLSHIVNESSEEEGEDETSGEIGSIENVPIEDADGDIVLDDSNEETVANRKRRRHSSL DSAKLIFNRAIVTEKGLRYNNENGSMPSKKALISISKGHGTLGRDATWDEFPNGRFGDSR SPAYGEIDGYGPSIKVSKSKALELWGIPKTIGDLKDIFIKYLEGSTDAIPWSDLGLSAET ALIQEELIQLNYRGYLTLASQPATNATLSSDKIFGWGPAKGRLYQKAFVEMFIHRQQWET TLKPKLDHYGRRKFSYYAGDSSGSFETNLDPHSSSVVTWGVFPNSPVKQTTIIEEESFKA WRDEAFSIWSEWAKLFPRNTPANILLRLVHKDYCLVSIVHHDFKETDELWEMLLDQA
References
External Links
ResourceLink
Saccharomyces Genome Database MET12
Uniprot IDP46151
Uniprot NameMTHR1_YEAST
GenBank Gene IDU36624
Genebank Protein ID1039454
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Yang, E., Friedberg, E. C. (1984). "Molecular cloning and nucleotide sequence analysis of the Saccharomyces cerevisiae RAD1 gene." Mol Cell Biol 4:2161-2169.6095044
  • Goyette, P., Sumner, J. S., Milos, R., Duncan, A. M., Rosenblatt, D. S., Matthews, R. G., Rozen, R. (1994). "Human methylenetetrahydrofolate reductase: isolation of cDNA, mapping and mutation identification." Nat Genet 7:195-200.7920641
  • Goyette, P., Sumner, J. S., Milos, R., Duncan, A. M., Rosenblatt, D. S., Matthews, R. G., Rozen, R. (1994). "Human methylenetetrahydrofolate reductase: isolation of cDNA mapping and mutation identification." Nat Genet 7:551.7951330
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956