You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-1,3-mannosyltransferase ALG2
Synonyms
  • Asparagine-linked glycosylation protein 2
  • GDP-Man:Man(1)GlcNAc(2)-PP-dolichol mannosyltransferase
Gene NameALG2
Enzyme Class
Biological Properties
General FunctionCell wall/membrane/envelope biogenesis
Specific FunctionMannosylates Man(2)GlcNAc(2)-dolichol diphosphate and Man(1)GlcNAc(2)-dolichol diphosphate to form Man(3)GlcNAc(2)- dolichol diphosphate
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein
SMPDB Pathways
N-Glycan biosynthesisPW002501 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
N-Glycan biosynthesisec00510 Map00510
SMPDB Reactions
Mannosyl-(N-acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate mannose(Mannosyl)2-(N-acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate + hydron
(Mannosyl)2-(N-acetylglucosaminyl)2-diphosphodolichol + Guanosine diphosphate mannoseGuanosine diphosphate + hydron + (Mannosyl)3-(N-acetylglucosaminyl)2-diphosphodolichol
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00257Guanosine diphosphateShow
YMDB00862hydronShow
YMDB16225(Mannosyl)2-(N-acetylglucosaminyl)2-diphosphodolicholShow
YMDB16226(Mannosyl)3-(N-acetylglucosaminyl)2-diphosphodolicholShow
YMDB16236Mannosyl-(N-acetylglucosaminyl)2-diphosphodolicholShow
GO Classification
Component
Not Available
Function
Not Available
Process
biosynthetic process
metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1512 bp ATGATTGAAAAGGATAAAAGAACGATTGCTTTTATTCATCCAGACCTAGGTATTGGGGGC GCTGAAAGGTTAGTCGTCGATGCAGCATTAGGTCTACAGCAACAAGGACATAGTGTAATC ATCTATACTAGTCACTGTGATAAATCACATTGTTTCGAAGAAGTTAAAAACGGCCAATTA AAAGTCGAAGTTTATGGTGATTTTTTACCGACAAACTTTTTGGGTCGTTTTTTTATTGTT TTCGCAACAATTAGACAGCTTTATTTAGTTATTCAATTGATCCTACAGAAAAAAGTGAAT GCGTACCAATTAATTATCATTGATCAACTGTCTACATGTATTCCGCTTCTGCATATCTTT AGTTCTGCCACTTTGATGTTTTATTGTCATTTCCCCGACCAATTATTGGCTCAAAGAGCT GGGCTATTGAAGAAAATATACAGACTACCATTTGACTTAATAGAACAGTTTTCCGTGAGT GCTGCCGATACTGTTGTGGTAAATTCAAATTTCACTAAGAATACGTTCCACCAAACGTTC AAGTATTTATCCAATGATCCAGACGTCATTTATCCATGCGTGGATTTATCAACAATCGAA ATTGAAGATATTGACAAGAAATTTTTCAAAACAGTGTTTAACGAAGGCGATAGATTTTAC CTAAGTATAAATCGTTTTGAGAAAAAAAAGGATGTTGCGCTGGCTATAAAGGCTTTTGCG TTATCTGAAGATCAAATCAATGACAACGTTAAGTTAGTTATTTGCGGTGGTTATGACGAG AGGGTTGCAGAAAATGTGGAGTACTTGAAGGAACTACAGTCTCTGGCCGATGAATACGAA TTATCCCATACAACCATATACTACCAAGAAATAAAGCGCGTCTCCGATTTAGAGTCATTC AAAACCAATAATAGTAAAATTATATTTTTAACTTCCATTTCATCATCTCTGAAAGAATTA CTGCTCGAAAGAACCGAAATGTTATTGTATACACCAGCATATGAGCACTTTGGTATTGTT CCTTTAGAAGCCATGAAATTAGGTAAGCCTGTACTAGCAGTAAACAATGGAGGTCCTTTG GAGACTATCAAATCTTACGTTGCTGGTGAAAATGAAAGTTCTGCCACTGGGTGGCTAAAA CCTGCCGTCCCTATTCAATGGGCTACTGCAATTGATGAAAGCAGAAAGATCTTGCAGAAC GGTTCTGTGAACTTTGAGAGGAATGGCCCGCTAAGAGTCAAGAAATACTTTTCTAGGGAA GCAATGACTCAGTCATTTGAAGAAAACGTCGAGAAAGTCATATGGAAAGAAAAAAAGTAT TATCCTTGGGAAATATTCGGTATTTCATTCTCTAATTTTATTTTGCATATGGCATTTATA AAAATTCTACCCAATAATCCATGGCCCTTCCTATTTATGGCCACTTTTATGGTATTATAT TTTAAGAACTACTTATGGGGAATTTACTGGGCATTTGTATTCGCTCTCTCCTACCCTTAT GAAGAAATATAA
Protein Properties
Pfam Domain Function
Protein Residues503
Protein Molecular Weight58046.5
Protein Theoretical pI6.2
Signalling Regions
  • None
Transmembrane Regions
  • 64-84
  • 112-132
  • 443-463
Protein Sequence>Alpha-1,3-mannosyltransferase ALG2 MIEKDKRTIAFIHPDLGIGGAERLVVDAALGLQQQGHSVIIYTSHCDKSHCFEEVKNGQL KVEVYGDFLPTNFLGRFFIVFATIRQLYLVIQLILQKKVNAYQLIIIDQLSTCIPLLHIF SSATLMFYCHFPDQLLAQRAGLLKKIYRLPFDLIEQFSVSAADTVVVNSNFTKNTFHQTF KYLSNDPDVIYPCVDLSTIEIEDIDKKFFKTVFNEGDRFYLSINRFEKKKDVALAIKAFA LSEDQINDNVKLVICGGYDERVAENVEYLKELQSLADEYELSHTTIYYQEIKRVSDLESF KTNNSKIIFLTSISSSLKELLLERTEMLLYTPAYEHFGIVPLEAMKLGKPVLAVNNGGPL ETIKSYVAGENESSATGWLKPAVPIQWATAIDESRKILQNGSVNFERNGPLRVKKYFSRE AMTQSFEENVEKVIWKEKKYYPWEIFGISFSNFILHMAFIKILPNNPWPFLFMATFMVLY FKNYLWGIYWAFVFALSYPYEEI
References
External Links
ResourceLink
Saccharomyces Genome Database ALG2
Uniprot IDP43636
Uniprot NameALG2_YEAST
GenBank Gene IDZ72587
Genebank Protein ID1322572
General Reference
  • O'Reilly, M. K., Zhang, G., Imperiali, B. (2006). "In vitro evidence for the dual function of Alg2 and Alg11: essential mannosyltransferases in N-linked glycoprotein biosynthesis." Biochemistry 45:9593-9603.16878994
  • Thiel, C., Schwarz, M., Peng, J., Grzmil, M., Hasilik, M., Braulke, T., Kohlschutter, A., von Figura, K., Lehle, L., Korner, C. (2003). "A new type of congenital disorders of glycosylation (CDG-Ii) provides new insights into the early steps of dolichol-linked oligosaccharide biosynthesis." J Biol Chem 278:22498-22505.12684507
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Jackson, B. J., Kukuruzinska, M. A., Robbins, P. (1993). "Biosynthesis of asparagine-linked oligosaccharides in Saccharomyces cerevisiae: the alg2 mutation." Glycobiology 3:357-364.8400550
  • Gao, X. D., Nishikawa, A., Dean, N. (2004). "Physical interactions between the Alg1, Alg2, and Alg11 mannosyltransferases of the endoplasmic reticulum." Glycobiology 14:559-570.15044395
  • Feuermann, M., de Montigny, J., Potier, S., Souciet, J. L. (1997). "The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes." Yeast 13:861-869.9234674
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212