You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCitrate synthase 3
SynonymsNot Available
Gene NameCIT3
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Specific FunctionAcetyl-CoA + H(2)O + oxaloacetate = citrate + CoA
Cellular LocationNot Available
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
SMPDB Reactions
Acetyl-CoA + water + Oxalacetic acidCitric acid + Coenzyme A
KEGG Reactions
propionyl-CoA + water + Oxalacetic acid(2S,3S)-2-Methylcitric acid + hydron + Coenzyme A
Acetyl-CoA + water + Oxalacetic acidhydron + Citric acid + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00086Citric acidShow
YMDB00235Oxalacetic acidShow
YMDB00312Acetyl-CoAShow
YMDB00446propionyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00978(2S,3S)-2-Methylcitric acidShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
catalytic activity
transferase activity
Process
cofactor metabolic process
coenzyme metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
cellular carbohydrate metabolic process
metabolic process
cellular metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR001W
Gene Sequence>1461 bp ATGGTACAAAGGCTTCTACCGGGCGCACATATATGCAGAAGGTCCTTCAATTCGTCTGCA ATTATAAAGTCTTCTGCATTGACTCTCAAGGAAGCATTAGAAAACGTGATACCTAAGAAA AGAGATGCTGTGAAGAAATTGAAGGCCTGTTATGGCAGCACGTTTGTCGGACCGATTACC ATTTCATCAGTTCTAGGTGGGATGAGAGGTAATCAGTCAATGTTTTGGCAAGGAACATCA TTAGATCCCGAACATGGCATTAAATTTCAAGGTTTAACGATTGAAGAATGTCAAAATAGA TTACCTAATACAGGTATTGATGGCGATAATTTCCTGCCAGAATCAATGTTATGGCTGTTG ATGACAGGTGGTGTGCCAACTTTCCAGCAAGCTGCTTCTTTCAGGAAAGAATTGGCTATT CGTGGAAGGAAATTGCCACATTATACAGAGAAAGTTTTGTCAAGTTTACCCAAAGATATG CACCCTATGACCCAACTTGCAATTGGTTTAGCATCAATGAACAAAGGATCCCTCTTTGCT ACAAACTACCAAAAGGGCCTCATAGGAAAGATGGAATTTTGGAAAGATACTCTTGAAGAT TCGCTAAATTTAATTGCTTCACTCCCGCTGCTGACTGGGAGAATTTATTCGAACATTACA AATGAGGGACACCCATTAGGTCAATATAGTGAGGAGGTGGATTGGTGTACAAACATATGT TCCCTGCTCGGCATGACAAATGGAACGAACTCTTCTAATACATGCAACCTTACTTCCCAG CAATCCCTGGACTTCATAAACTTGATGCGGTTATATACCGGTATACATGTAGACCATGAA GGTGGTAATGTTTCTGCTCACACCACCCACTTGGTTGGAAGTGCGTTGAGTGACCCGTAT CTCAGCTATTCATCTGGAATAATGGGATTAGCGGGTCCTTTGCATGGGTTAGCAGCACAA GAAGTAGTAAGGTTTCTCATAGAGATGAACTCTAATATTTCCAGCATTGCACGAGAACAA GAAATCAAAGATTATCTTTGGAAAATTTTGAATTCAAACCGTGTGATCCCCGGTTATGGG CACGCAGTTTTGCGTAAACCGGATCCTCGATTTACAGCAATGCTTGAATTTGCGCAAAAG AGGCCTATTGAATTTGAGAACGACAAGAACGTTTTGTTGATGCAAAAATTGGCAGAAATA GCGCCTAAGGTTTTGTTGGAACACGGAAAGAGTAAGAATCCATTTCCCAATGTTGACTCT GCATCGGGGATTTTGTTTTATCATTATGGAATCAGGGAATTATTATTCTTTACCGTCATT TTTGGGTGTTCAAGGGCCATGGGACCCTTGACACAACTTGTTTGGGATCGCATTCTAGGT TTACCAATTGAAAGGCCCAAGAGTTTGAACTTGGAGGGTCTGGAAGCACTTACCAAAGCA AGCAATGTTAACAAGTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues486
Protein Molecular Weight53810.69922
Protein Theoretical pI8.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Citrate synthase 3 MVQRLLPGAHICRRSFNSSAIIKSSALTLKEALENVIPKKRDAVKKLKACYGSTFVGPIT ISSVLGGMRGNQSMFWQGTSLDPEHGIKFQGLTIEECQNRLPNTGIDGDNFLPESMLWLL MTGGVPTFQQAASFRKELAIRGRKLPHYTEKVLSSLPKDMHPMTQLAIGLASMNKGSLFA TNYQKGLIGKMEFWKDTLEDSLNLIASLPLLTGRIYSNITNEGHPLGQYSEEVDWCTNIC SLLGMTNGTNSSNTCNLTSQQSLDFINLMRLYTGIHVDHEGGNVSAHTTHLVGSALSDPY LSYSSGIMGLAGPLHGLAAQEVVRFLIEMNSNISSIAREQEIKDYLWKILNSNRVIPGYG HAVLRKPDPRFTAMLEFAQKRPIEFENDKNVLLMQKLAEIAPKVLLEHGKSKNPFPNVDS ASGILFYHYGIRELLFFTVIFGCSRAMGPLTQLVWDRILGLPIERPKSLNLEGLEALTKA SNVNKL
References
External Links
ResourceLink
Saccharomyces Genome Database CIT3
Uniprot IDP43635
Uniprot NameCISY3_YEAST
GenBank Gene IDU31900
Genebank Protein ID939735
General Reference
  • Graybill, E. R., Rouhier, M. F., Kirby, C. E., Hawes, J. W. (2007). "Functional comparison of citrate synthase isoforms from S. cerevisiae." Arch Biochem Biophys 465:26-37.17570335
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875