You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexose transporter HXT10
SynonymsNot Available
Gene NameHXT10
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
substrate-specific transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 6
LocusYFL011W
Gene Sequence>1641 bp ATGGTTAGTTCAAGTGTTTCCATTTTGGGGACTAGCGCCAAGGCATCCACTTCTCTAAGT AGAAAGGATGAAATTAAACTAACCCCTGAAACAAGGGAAGCTAGCTTGGACATTCCATAC AAACCCATTATTGCATACTGGACGGTGATGGGTCTCTGTCTGATGATTGCCTTTGGTGGA TTCATTTTTGGTTGGGATACAGGAACCATTTCAGGGTTTATTAACCAAACAGATTTCAAG AGAAGGTTTGGTGAGTTACAAAGGGACGGCAGTTTTCAACTATCAGATGTCAGGACAGGG CTAATTGTCGGTATCTTCAACATAGGTTGTGCTTTAGGTGGCCTAACGCTGGGACGCCTG GGCGATATTTATGGGCGTAAAATCGGCTTAATGTGTGTTATACTGGTGTATGTTGTTGGT ATCGTGATCCAGATTGCTTCCTCTGACAAATGGTATCAATATTTTATTGGTAGAATTGTT TCTGGAATGGGTGTTGGAGGTGTTGCTGTGCTGTCGCCAACTTTGATCTCAGAAATTTCC CCAAAGCACCTAAGAGGCACTTGTGTCTCTTTTTACCAGCTAATGATTACCCTTGGAATT TTCTTGGGCTACTGTACCAATTATGGTACAAAGAAATATTCAAATTCAATACAGTGGCGG GTTCCCTTGGGTTTGTGTTTTGCGTGGGCAATCTTTATGGTGATTGGAATGGTTATGGTT CCGGAATCGCCCAGATATTTAGTAGAAAAAGGTAAGTATGAAGAAGCTAGAAGGTCTTTG GCCAAATCAAACAAGGTCACAGTTACTGATCCAGGCGTTGTTTTTGAGTTTGATACTATA GTTGCAAATATGGAATTAGAAAGGGCTGTTGGAAATGCCAGTTGGCACGAACTCTTCTCA AATAAAGGAGCAATTCTACCAAGGGTAATAATGGGAATCGTTATCCAGTCACTGCAACAG CTTACTGGCTGTAATTATTTTTTCTACTACGGCACGACCATTTTCAATGCTGTTGGAATG CAAGACTCTTTCGAGACTTCCATTGTCCTTGGGGCTGTTAATTTTGCTTCTACATTTGTT GCACTATACATTGTGGATAAATTTGGGCGTCGAAAATGTTTATTGTGGGGGTCTGCCTCG ATGGCAATTTGTTTCGTCATATTCGCCACCGTTGGCGTCACTAGATTATGGCCACAAGGG AAAGACCAACCTTCTTCGCAAAGTGCTGGTAATGTTATGATCGTTTTTACTTGTTTCTTC ATTTTCTCTTTTGCCATTACTTGGGCTCCTATCGCCTATGTCATTGTGGCAGAAACTTAT CCATTAAGAGTTAAAAATCGTGCCATGGCCATTGCGGTTGGTGCGAACTGGATGTGGGGT TTCTTGATTGGATTTTTCACACCCTTTATCACTAGATCCATAGGATTTTCTTATGGCTAT GTTTTCATGGGTTGCTTAATCTTTTCGTACTTCTACGTTTTCTTCTTTGTTTGCGAAACA AAGGGATTAACTCTGGAGGAAGTTAATGAAATGTACGAAGAAAGAATAAAGCCATGGAAG TCCGGAGGTTGGATTCCCAGTTCTAGAAGAACACCACAACCAACAAGCAGTACACCATTA GTTATTGTTGATAGTAAATAA
Protein Properties
Pfam Domain Function
Protein Residues546
Protein Molecular Weight60661.5
Protein Theoretical pI9.11
Signalling Regions
  • None
Transmembrane Regions
  • 45-65
  • 101-121
  • 128-148
  • 159-179
  • 186-206
  • 221-241
  • 325-341
  • 348-365
  • 373-393
  • 416-436
  • 454-474
  • 476-496
Protein Sequence>Hexose transporter HXT10 MVSSSVSILGTSAKASTSLSRKDEIKLTPETREASLDIPYKPIIAYWTVMGLCLMIAFGG FIFGWDTGTISGFINQTDFKRRFGELQRDGSFQLSDVRTGLIVGIFNIGCALGGLTLGRL GDIYGRKIGLMCVILVYVVGIVIQIASSDKWYQYFIGRIVSGMGVGGVAVLSPTLISEIS PKHLRGTCVSFYQLMITLGIFLGYCTNYGTKKYSNSIQWRVPLGLCFAWAIFMVIGMVMV PESPRYLVEKGKYEEARRSLAKSNKVTVTDPGVVFEFDTIVANMELERAVGNASWHELFS NKGAILPRVIMGIVIQSLQQLTGCNYFFYYGTTIFNAVGMQDSFETSIVLGAVNFASTFV ALYIVDKFGRRKCLLWGSASMAICFVIFATVGVTRLWPQGKDQPSSQSAGNVMIVFTCFF IFSFAITWAPIAYVIVAETYPLRVKNRAMAIAVGANWMWGFLIGFFTPFITRSIGFSYGY VFMGCLIFSYFYVFFFVCETKGLTLEEVNEMYEERIKPWKSGGWIPSSRRTPQPTSSTPL VIVDSK
References
External Links
ResourceLink
Saccharomyces Genome Database HXT10
Uniprot IDP43581
Uniprot NameHXT10_YEAST
GenBank Gene IDD50617
Genebank Protein ID836743
General Reference
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258