You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGeneral amino acid permease AGP3
SynonymsNot Available
Gene NameAGP3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionGeneral amino acid permease with broad substrate specificity
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00112L-SerineShow
YMDB00271L-Glutamic acidShow
YMDB00862hydronShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
amine transmembrane transporter activity
amino acid transmembrane transporter activity
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 6
LocusYFL055W
Gene Sequence>1677 bp ATGGCAGTCCTTAACTTGAAACGTGAAACTGTCGACATTGAAGAGACAGCGAAGAAAGAT ATCAAACCTTATTTTGCTTCGAATGTTGAAGCGGTTGATATTGATGAAGATCCCGATGTT TCAAGATACGATCCCCAGACAGGAGTGAAAAGGGCGCTCAAAAATAGGCATATCTCATTG CTAGCTTTGGGTGGTGTTATTGGCCCAGGTTGTCTTGTTGGTGCAGGAAACGCACTCAAC AAAGGTGGGCCACTTGCTTTACTTTTAGGCTTTAGTATTATTGGGATCATTGCTTTCTCA GTGATGGAATCTATAGGTGAAATGATCACTTTATATCCCTCGGGCGGTGGATTTACCACT TTGGCTCGAAGATTTCATAGCGATGCACTGCCTGCAGTTTGCGGTTATGCTTACGTTGTT GTGTTCTTCGCAGTTTTGGCAAATGAGTACAACACTCTCTCCTCCATACTACAGTTTTGG GGCCCACAAGTCCCTCTATATGGTTACATCTTGATATTCTGGTTTGCATTTGAAATTTTT CAACTAGTTGGCGTTGGTCTTTTTGGTGAAACGGAGTACTGGCTTGCTTGGTTGAAAATA GTAGGATTAGTAGCCTATTATATTTTCTCGATTGTTTACATATCTGGGGATATTAGGAAT AGACCAGCTTTCGGCTTTCATTATTGGAATAGTCCAGGTGCATTATCACATGGGTTTAAG GGAATTGCGATAGTGTTTGTGTTTTGTTCGACCTTCTATTCTGGAACGGAATCAGTTGCC TTGGCTGCAACGGAATCAAAAAACCCTGGGAAGGCTGTGCCACTTGCTGTTCGACAAACT CTGTGGAGAATTTTAGTTGTTTATATTGGAATTGCTGTTTTCTATGGAGCAACTGTTCCG TTTGACGACCCAAACCTCTCTGCTTCTACCAAAGTCCTAAAATCTCCCATTGCTATCGCC ATATCTCGTGCTGGTTGGGCCGGCGGAGCTCATCTGGTTAATGCCTTCATTTTGATAACT TGCATCTCCGCCATTAATGGGTCACTTTATATAGGGAGCAGAACCTTGACGCATTTAGCA CATGAAGGCCTAGCTCCAAAAATTCTGGCTTGGACCGATCGAAGAGGCGTTCCCATCCCC GCCATCACTGTTTTCAACGCCTTGGGCCTAATATCATTGATGAATGTGAGCGTTGGAGCT GCAAATGCGTACTCTTATATCGTTAATCTTTCTGGTGTTGGCGTCTTTATTGTCTGGGGT GTAATAAGTTATACGCACCTGAGAATAAGGAAGGCGTGGGTTGCTCAAGGAAGATCCATA GAAGAGCTACCTTATGAAGCGCTATTTTATCCGTGGACGCCAGTACTTAGTCTGGCCGCT AACATTTTTCTAGCACTCATCCAAGGATGGAGCTATTTCGTACCTTTTGATGCGGGCAAT TTTGTTGATGCTTATATCCTTCTGCCTGTTGGAATTTTATTGTATATTGGCATATGTGTT TTTAAGAGCAATCATTTTAGAACTGTTGATTTGCGGTCAATCAACCTAGACGAAGGACGA AGAAAAGACATGGAGGCTGATCTTTCTGATCAAGAGAGTAGCTTAGCATCTTCGGAAACG ATGAAGGATTATAAAAGTGCAACTTTTTTCAGATACCTCAGCAACATTTTCACCTGA
Protein Properties
Pfam Domain Function
Protein Residues558
Protein Molecular Weight61051.19922
Protein Theoretical pI7.58
Signalling Regions
  • None
Transmembrane Regions
  • 58-78
  • 82-102
  • 127-147
  • 169-189
  • 194-214
  • 242-262
  • 281-301
  • 325-345
  • 376-396
  • 403-423
  • 447-467
  • 481-501
Protein Sequence>General amino acid permease AGP3 MAVLNLKRETVDIEETAKKDIKPYFASNVEAVDIDEDPDVSRYDPQTGVKRALKNRHISL LALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGFTT LARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYGYILIFWFAFEIF QLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSPGALSHGFK GIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVP FDDPNLSASTKVLKSPIAIAISRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLA HEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWG VISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSLAANIFLALIQGWSYFVPFDAGN FVDAYILLPVGILLYIGICVFKSNHFRTVDLRSINLDEGRRKDMEADLSDQESSLASSET MKDYKSATFFRYLSNIFT
References
External Links
ResourceLink
Saccharomyces Genome Database AGP3
Uniprot IDP43548
Uniprot NameAGP3_YEAST
GenBank Gene IDD50617
Genebank Protein ID836700
General Reference
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258