You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUDP-N-acetylglucosamine pyrophosphorylase
SynonymsNot Available
Gene NameQRI1
Enzyme Class
Biological Properties
General FunctionInvolved in UDP-N-acetylglucosamine diphosphorylase act
Specific FunctionUTP + N-acetyl-alpha-D-glucosamine 1-phosphate = diphosphate + UDP-N-acetyl-D-glucosamine
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
N-Acetyl-glucosamine 1-phosphate + Uridine triphosphate + hydronPyrophosphate + Uridine diphosphate-N-acetylglucosamine
KEGG Reactions
Uridine triphosphate + N-acetyl-alpha-D-glucosamine 1-phosphate + hydronPyrophosphate + Uridine diphosphate-N-acetylglucosamine
Metabolites
YMDB IDNameView
YMDB00043N-Acetyl-glucosamine 1-phosphateShow
YMDB00219PyrophosphateShow
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00326Uridine triphosphateShow
YMDB00751N-acetyl-alpha-D-glucosamine 1-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL103C
Gene Sequence>1434 bp ATGACTGACACAAAACAGCTATTCATTGAAGCCGGACAAAGTCAACTTTTCCACAATTGG GAAAGCTTGTCTCGCAAAGACCAAGAAGAATTGCTTTCAAACCTGGAGCAAATATCTTCC AAGAGGTCCCCTGCAAAACTACTGGAAGACTGTCAAAATGCTATTAAATTCTCACTAGCT AACTCTTCTAAGGATACTGGCGTCGAAATTTCACCATTGCCCCCTACTTCGTACGAGTCG CTTATTGGCAACAGTAAGAAAGAAAATGAATACTGGCGTTTAGGCCTTGAAGCTATTGGC AAGGGTGAAGTCGCAGTGATTTTAATGGCTGGCGGACAAGGTACGCGGTTAGGATCCTCT CAACCAAAGGGCTGTTACGACATTGGATTGCCTTCTAAGAAATCTCTTTTTCAAATTCAA GCTGAAAAGTTGATCAGGTTGCAAGATATGGTAAAGGACAAAAAGGTAGAAATTCCTTGG TATATTATGACATCAGGCCCCACTAGAGCGGCTACTGAGGCATACTTTCAAGAACACAAT TATTTTGGCTTGAATAAAGAACAAATTACGTTCTTCAACCAGGGAACCCTGCCTGCCTTT GATTTAACCGGGAAGCATTTCCTAATGAAAGACCCAGTAAACCTATCTCAATCACCAGAT GGAAATGGTGGACTCTACCGTGCCATCAAGGAAAACAAGTTGAACGAAGACTTTGATAGG AGAGGAATCAAGCATGTTTACATGTACTGTGTCGATAATGTCCTATCTAAAATCGCAGAC CCTGTATTTATTGGTTTTGCCATCAAGCATGGCTTCGAACTGGCCACCAAAGCCGTTAGA AAGAGAGATGCGCATGAATCAGTTGGGTTAATTGCTACTAAAAACGAGAAACCATGTGTC ATAGAATATTCTGAAATTTCCAATGAATTGGCTGAAGCAAAGGATAAAGATGGCTTATTA AAACTACGCGCAGGCAACATTGTAAATCATTATTACCTAGTGGATTTACTAAAACGTGAT TTGGATCAGTGGTGTGAGAATATGCCATATCACATTGCGAAGAAGAAAATTCCAGCTTAT GATAGTGTTACCGGCAAGTACACTAAGCCTACCGAACCAAACGGTATAAAATTAGAGCAA TTCATATTTGATGTCTTTGACACTGTACCACTGAACAAGTTTGGGTGCTTAGAAGTAGAT AGATGCAAAGAATTTTCACCTTTAAAAAACGGTCCTGGTTCTAAGAACGATAATCCTGAG ACCAGCAGACTAGCATATTTGAAACTAGGAACCTCGTGGTTGGAAGATGCAGGCGCTATT GTAAAAGATGGGGTACTAGTCGAAGTTTCCAGCAAATTGAGTTATGCAGGTGAAAATCTA TCCCAGTTCAAAGGTAAAGTCTTTGACAGAAGTGGTATAGTATTAGAAAAATAA
Protein Properties
Pfam Domain Function
Protein Residues477
Protein Molecular Weight53475.60156
Protein Theoretical pI7.49
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>UDP-N-acetylglucosamine pyrophosphorylase MTDTKQLFIEAGQSQLFHNWESLSRKDQEELLSNLEQISSKRSPAKLLEDCQNAIKFSLA NSSKDTGVEISPLPPTSYESLIGNSKKENEYWRLGLEAIGKGEVAVILMAGGQGTRLGSS QPKGCYDIGLPSKKSLFQIQAEKLIRLQDMVKDKKVEIPWYIMTSGPTRAATEAYFQEHN YFGLNKEQITFFNQGTLPAFDLTGKHFLMKDPVNLSQSPDGNGGLYRAIKENKLNEDFDR RGIKHVYMYCVDNVLSKIADPVFIGFAIKHGFELATKAVRKRDAHESVGLIATKNEKPCV IEYSEISNELAEAKDKDGLLKLRAGNIVNHYYLVDLLKRDLDQWCENMPYHIAKKKIPAY DSVTGKYTKPTEPNGIKLEQFIFDVFDTVPLNKFGCLEVDRCKEFSPLKNGPGSKNDNPE TSRLAYLKLGTSWLEDAGAIVKDGVLVEVSSKLSYAGENLSQFKGKVFDRSGIVLEK
References
External Links
ResourceLink
Saccharomyces Genome Database QRI1
Uniprot IDP43123
Uniprot NameUAP1_YEAST
GenBank Gene IDAB011272
Genebank Protein ID3273318
General Reference
  • Mio, T., Yabe, T., Arisawa, M., Yamada-Okabe, H. (1998). "The eukaryotic UDP-N-acetylglucosamine pyrophosphorylases. Gene cloning, protein expression, and catalytic mechanism." J Biol Chem 273:14392-14397.9603950
  • Simon, M., Benit, P., Vassal, A., Dubois, C., Faye, G. (1994). "Sequence of the PHO2-POL3 (CDC2) region of chromosome IV of Saccharomyces cerevisiae." Yeast 10:1653-1656.7725801
  • Saiz, J. E., Buitrago, M. J., Garcia, R., Revuelta, J. L., Del Rey, F. (1996). "The sequence of a 20.3 kb DNA fragment from the left arm of Saccharomyces cerevisiae chromosome IV contains the KIN28, MSS2, PHO2, POL3 and DUN1 genes, and six new open reading frames." Yeast 12:1077-1084.8896274
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956