You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoserine phosphatase
Synonyms
  • PSP
  • PSPase
  • O-phosphoserine phosphohydrolase
Gene NameSER2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionO-phospho-L(or D)-serine + H(2)O = L(or D)- serine + phosphate
Cellular LocationCytoplasmic
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Methane metabolismec00680 Map00680
SMPDB Reactions
DL-O-Phosphoserine + waterphosphate + L-Serine
KEGG Reactions
O-Phospho-L-serine + waterL-Serine + phosphate
Metabolites
YMDB IDNameView
YMDB00076DL-O-PhosphoserineShow
YMDB00112L-SerineShow
YMDB00761O-Phospho-L-serineShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
catalytic activity
phosphoserine phosphatase activity
Process
serine family amino acid metabolic process
L-serine metabolic process
metabolic process
L-serine biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR208W
Gene Sequence>930 bp ATGTCAAAGTTTGTTATCACCTGCATAGCTCATGGAGAAAATCTCCCAAAAGAAACCATC GACCAGATTGCGAAAGAAATTACTGAAAGCTCGGCGAAAGATGTATCAATCAATGGTACC AAGAAACTATCGGCCAGAGCTACCGATATATTCATTGAAGTCGCAGGATCGATTGTTCAA AAAGACCTCAAGAATAAGCTGACGAACGTCATTGACAGTCATAATGATGTTGATGTTATT GTTTCTGTCGACAATGAATATCGTCAAGCCAAAAAGCTCTTTGTCTTTGACATGGATTCA ACATTAATCTACCAAGAGGTCATCGAATTGATTGCCGCTTATGCTGGTGTTGAAGAACAA GTGCACGAGATCACAGAAAGAGCCATGAACAATGAACTTGATTTCAAAGAGTCTTTAAGA GAACGCGTTAAATTATTGCAAGGCCTCCAAGTCGATACACTATATGATGAAATAAAACAA AAGCTAGAGGTCACCAAGGGTGTGCCAGAACTATGCAAGTTCCTTCACAAAAAAAATTGC AAGCTCGCTGTTTTAAGCGGTGGTTTTATTCAGTTTGCCGGTTTTATCAAGGATCAGTTA GGTTTAGATTTTTGTAAGGCAAACTTGTTGGAAGTTGACACTGATGGAAAATTAACCGGT AAAACACTGGGTCCTATCGTAGACGGACAGTGCAAGAGTGAAACCCTTCTGCAACTATGT AATGACTACAATGTTCCAGTTGAAGCAAGTTGTATGGTGGGTGACGGTGGTAACGACCTG CCAGCCATGGCTACCGCCGGGTTTGGGATCGCATGGAACGCCAAGCCAAAGGTGCAGAAA GCTGCACCTTGTAAGTTGAATACCAAGAGCATGACTGACATTTTATACATTCTTGGTTAC ACCGATGATGAAATATACAATAGACAATGA
Protein Properties
Pfam Domain Function
Protein Residues309
Protein Molecular Weight34207.0
Protein Theoretical pI4.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoserine phosphatase MSKFVITCIAHGENLPKETIDQIAKEITESSAKDVSINGTKKLSARATDIFIEVAGSIVQ KDLKNKLTNVIDSHNDVDVIVSVDNEYRQAKKLFVFDMDSTLIYQEVIELIAAYAGVEEQ VHEITERAMNNELDFKESLRERVKLLQGLQVDTLYDEIKQKLEVTKGVPELCKFLHKKNC KLAVLSGGFIQFAGFIKDQLGLDFCKANLLEVDTDGKLTGKTLGPIVDGQCKSETLLQLC NDYNVPVEASCMVGDGGNDLPAMATAGFGIAWNAKPKVQKAAPCKLNTKSMTDILYILGY TDDEIYNRQ
References
External Links
ResourceLink
Saccharomyces Genome Database SER2
Uniprot IDP42941
Uniprot NameSERB_YEAST
GenBank Gene IDU36473
Genebank Protein ID1015428
General Reference
  • Guerreiro, P., Barreiros, T., Soares, H., Cyrne, L., Maia e Silva, A., Rodrigues-Pousada, C. (1996). "Sequencing of a 17.6 kb segment on the right arm of yeast chromosome VII reveals 12 ORFs, including CCT, ADE3 and TR-I genes, homologues of the yeast PMT and EF1G genes, of the human and bacterial electron-transferring flavoproteins (beta-chain) and of the Escherichia coli phosphoserine phosphohydrolase, and five new ORFs." Yeast 12:273-280.8904340
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106