You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameXylulose kinase
Synonyms
  • Xylulokinase
Gene NameXKS1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, alcohol group as acceptor
Specific FunctionATP + D-xylulose = ADP + D-xylulose 5- phosphate
Cellular LocationCytoplasm
SMPDB Pathways
xylitol degradationPW002433 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pentose and glucuronate interconversionsec00040 Map00040
SMPDB Reactions
D-Xylulose + Adenosine triphosphateXylulose 5-phosphate + ADP + hydron
KEGG Reactions
Adenosine triphosphate + D-Xylulosehydron + Xylulose 5-phosphate + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00161D-XyluloseShow
YMDB00362Xylulose 5-phosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, alcohol group as acceptor
catalytic activity
transferase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR194C
Gene Sequence>1803 bp ATGTTGTGTTCAGTAATTCAGAGACAGACAAGAGAGGTTTCCAACACAATGTCTTTAGAC TCATACTATCTTGGGTTTGATCTTTCGACCCAACAACTGAAATGTCTCGCCATTAACCAG GACCTAAAAATTGTCCATTCAGAAACAGTGGAATTTGAAAAGGATCTTCCGCATTATCAC ACAAAGAAGGGTGTCTATATACACGGCGACACTATCGAATGTCCCGTAGCCATGTGGTTA GAGGCTCTAGATCTGGTTCTCTCGAAATATCGCGAGGCTAAATTTCCATTGAACAAAGTT ATGGCCGTCTCAGGGTCCTGCCAGCAGCACGGGTCTGTCTACTGGTCCTCCCAAGCCGAA TCTCTGTTAGAGCAATTGAATAAGAAACCGGAAAAAGATTTATTGCACTACGTGAGCTCT GTAGCATTTGCAAGGCAAACCGCCCCCAATTGGCAAGACCACAGTACTGCAAAGCAATGT CAAGAGTTTGAAGAGTGCATAGGTGGGCCTGAAAAAATGGCTCAATTAACAGGGTCCAGA GCCCATTTTAGATTTACTGGTCCTCAAATTCTGAAAATTGCACAATTAGAACCAGAAGCT TACGAAAAAACAAAGACCATTTCTTTAGTGTCTAATTTTTTGACTTCTATCTTAGTGGGC CATCTTGTTGAATTAGAGGAGGCAGATGCCTGTGGTATGAACCTTTATGATATACGTGAA AGAAAATTCAGTGATGAGCTACTACATCTAATTGATAGTTCTTCTAAGGATAAAACTATC AGACAAAAATTAATGAGAGCACCCATGAAAAATTTGATAGCGGGTACCATCTGTAAATAT TTTATTGAGAAGTACGGTTTCAATACAAACTGCAAGGTCTCTCCCATGACTGGGGATAAT TTAGCCACTATATGTTCTTTACCCCTGCGGAAGAATGACGTTCTCGTTTCCCTAGGAACA AGTACTACAGTTCTTCTGGTCACCGATAAGTATCACCCCTCTCCGAACTATCATCTTTTC ATTCATCCAACTCTGCCAAACCATTATATGGGTATGATTTGTTATTGTAATGGTTCTTTG GCAAGGGAGAGGATAAGAGACGAGTTAAACAAAGAACGGGAAAATAATTATGAGAAGACT AACGATTGGACTCTTTTTAATCAAGCTGTGCTAGATGACTCAGAAAGTAGTGAAAATGAA TTAGGTGTATATTTTCCTCTGGGGGAGATCGTTCCTAGCGTAAAAGCCATAAACAAAAGG GTTATCTTCAATCCAAAAACGGGTATGATTGAAAGAGAGGTGGCCAAGTTCAAAGACAAG AGGCACGATGCCAAAAATATTGTAGAATCACAGGCTTTAAGTTGCAGGGTAAGAATATCT CCCCTGCTTTCGGATTCAAACGCAAGCTCACAACAGAGACTGAACGAAGATACAATCGTG AAGTTTGATTACGATGAATCTCCGCTGCGGGACTACCTAAATAAAAGGCCAGAAAGGACT TTTTTTGTAGGTGGGGCTTCTAAAAACGATGCTATTGTGAAGAAGTTTGCTCAAGTCATT GGTGCTACAAAGGGTAATTTTAGGCTAGAAACACCAAACTCATGTGCCCTTGGTGGTTGT TATAAGGCCATGTGGTCATTGTTATATGACTCTAATAAAATTGCAGTTCCTTTTGATAAA TTTCTGAATGACAATTTTCCATGGCATGTAATGGAAAGCATATCCGATGTGGATAATGAA AATTGGGATCGCTATAATTCCAAGATTGTCCCCTTAAGCGAACTGGAAAAGACTCTCATC TAA
Protein Properties
Pfam Domain Function
Protein Residues600
Protein Molecular Weight68320.29688
Protein Theoretical pI6.82
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Xylulose kinase MLCSVIQRQTREVSNTMSLDSYYLGFDLSTQQLKCLAINQDLKIVHSETVEFEKDLPHYH TKKGVYIHGDTIECPVAMWLEALDLVLSKYREAKFPLNKVMAVSGSCQQHGSVYWSSQAE SLLEQLNKKPEKDLLHYVSSVAFARQTAPNWQDHSTAKQCQEFEECIGGPEKMAQLTGSR AHFRFTGPQILKIAQLEPEAYEKTKTISLVSNFLTSILVGHLVELEEADACGMNLYDIRE RKFSDELLHLIDSSSKDKTIRQKLMRAPMKNLIAGTICKYFIEKYGFNTNCKVSPMTGDN LATICSLPLRKNDVLVSLGTSTTVLLVTDKYHPSPNYHLFIHPTLPNHYMGMICYCNGSL ARERIRDELNKERENNYEKTNDWTLFNQAVLDDSESSENELGVYFPLGEIVPSVKAINKR VIFNPKTGMIEREVAKFKDKRHDAKNIVESQALSCRVRISPLLSDSNASSQQRLNEDTIV KFDYDESPLRDYLNKRPERTFFVGGASKNDAIVKKFAQVIGATKGNFRLETPNSCALGGC YKAMWSLLYDSNKIAVPFDKFLNDNFPWHVMESISDVDNENWDRYNSKIVPLSELEKTLI
References
External Links
ResourceLink
Saccharomyces Genome Database XKS1
Uniprot IDP42826
Uniprot NameXKS1_YEAST
GenBank Gene IDZ72979
Genebank Protein ID1323345
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Arroyo, J., Garcia-Gonzalez, M., Garcia-Saez, M. I., Sanchez, M., Nombela, C. (1995). "The complete sequence of a 9037 bp DNA fragment of the right arm of Saccharomyces cerevisiae chromosome VII." Yeast 11:587-591.7645350
  • Rodriguez-Pena, J. M., Cid, V. J., Arroyo, J., Nombela, C. (1998). "The YGR194c (XKS1) gene encodes the xylulokinase from the budding yeast Saccharomyces cerevisiae." FEMS Microbiol Lett 162:155-160.9595677
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106