You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAmmonium transporter MEP2
SynonymsNot Available
Gene NameMEP2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ammonium transmembrane transporter activity
Specific FunctionTransporter for ammonium (both charged and uncharged NH3 and NH4) to use as a nitrogen source. The affinity of MEP2 is about twenty times higher than that of MEP1. MEP3 has the lowest affinity. Under ammonium limitation acts as an ammonium sensor, generating a signal that leads to pseudohyphal growth
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00423AmmoniumShow
GO Classification
Component
cell part
membrane
Function
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
organic cation transmembrane transporter activity
ammonium transmembrane transporter activity
transporter activity
transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 14
LocusYNL142W
Gene Sequence>1500 bp ATGTCTTACAATTTTACAGGTACGCCTACAGGCGAAGGAACGGGTGGTAACTCGTTGACA ACAGATTTGAATACACAATTTGACTTGGCCAACATGGGATGGATCGGTGTGGCTTCAGCA GGTGTGTGGATTATGGTCCCAGGTATCGGTTTATTATATTCTGGTTTATCCAGGAAAAAG CATGCTTTATCCTTGCTTTGGGCCTCGATGATGGCTTCCGCCGTGTGTATTTTCCAATGG TTTTTCTGGGGATACTCATTAGCTTTCTCACACAACACTAGAGGTAACGGTTTTATTGGT ACCTTGGAATTCTTTGGGTTTCGTAACGTTTTAGGAGCCCCATCTAGTGTCAGTTCTCTT CCCGATATACTGTTTGCCGTTTACCAAGGTATGTTTGCCGCAGTCACCGGTGCCCTAATG CTAGGTGGTGCCTGCGAGAGGGCAAGGTTGTTTCCTATGATGGTGTTCTTGTTTTTATGG ATGACTATTGTTTATTGTCCTATTGCATGCTGGGTCTGGAATGCCGAGGGTTGGTTGGTC AAATTGGGTAGCTTGGACTATGCAGGTGGTTTATGTGTCCATTTAACATCTGGACATGGT GGTCTAGTTTACGCTTTGATACTGGGTAAGCGTAATGACCCTGTTACACGTAAAGGGATG CCCAAGTACAAACCACATTCCGTCACCTCGGTGGTTTTAGGCACAGTGTTCTTATGGTTT GGTTGGATGTTCTTTAACGGAGGCTCTGCAGGTAATGCAACTATACGAGCATGGTACTCT ATTATGTCCACAAACTTAGCTGCTGCTTGCGGTGGCTTGACATGGATGGTTATCGATTAT TTCAGATGCGGAAGAAAGTGGACTACAGTTGGTTTGTGTTCAGGTATCATCGCTGGCCTA GTGGGTATCACCCCAGCCGCCGGGTTCGTGCCAATCTGGTCAGCCGTTGTCATTGGTGTG GTTACTGGTGCAGGATGTAACCTTGCTGTTGACTTAAAGAGTCTATTGCGCATCGATGAT GGTCTAGATTGTTACTCTATCCATGGTGTGGGTGGTTGTATTGGTTCTGTATTAACTGGT ATCTTTGCTGCAGACTATGTAAATGCCACTGCAGGCTCTTACATTAGTCCAATTGATGGT GGCTGGATCAATCATCACTATAAACAAGTTGGTTATCAATTAGCAGGTATATGCGCTGCA CTAGCCTGGACTGTTACTGTCACATCTATCTTGCTTCTAACTATGAATGCCATTCCATTT TTAAAACTAAGATTAAGTGCTGATGAGGAAGAATTAGGTACCGACGCTGCTCAAATTGGT GAATTTACATACGAGGAATCCACTGCTTACATCCCAGAACCAATCAGATCTAAAACATCG GCACAAATGCCACCTCCTCATGAAAACATTGATGATAAGATTGTGGGTAACACAGACGCA GAAAAGAATTCTACGCCTTCCGACGCTTCTTCTACTAAGAACACTGACCATATAGTATAA
Protein Properties
Pfam Domain Function
Protein Residues499
Protein Molecular Weight53400.19922
Protein Theoretical pI6.66
Signalling Regions
  • None
Transmembrane Regions
  • 32-52
  • 63-83
  • 123-143
  • 153-173
  • 188-208
  • 231-251
  • 258-278
  • 301-321
  • 347-367
  • 394-414
Protein Sequence>Ammonium transporter MEP2 MSYNFTGTPTGEGTGGNSLTTDLNTQFDLANMGWIGVASAGVWIMVPGIGLLYSGLSRKK HALSLLWASMMASAVCIFQWFFWGYSLAFSHNTRGNGFIGTLEFFGFRNVLGAPSSVSSL PDILFAVYQGMFAAVTGALMLGGACERARLFPMMVFLFLWMTIVYCPIACWVWNAEGWLV KLGSLDYAGGLCVHLTSGHGGLVYALILGKRNDPVTRKGMPKYKPHSVTSVVLGTVFLWF GWMFFNGGSAGNATIRAWYSIMSTNLAAACGGLTWMVIDYFRCGRKWTTVGLCSGIIAGL VGITPAAGFVPIWSAVVIGVVTGAGCNLAVDLKSLLRIDDGLDCYSIHGVGGCIGSVLTG IFAADYVNATAGSYISPIDGGWINHHYKQVGYQLAGICAALAWTVTVTSILLLTMNAIPF LKLRLSADEEELGTDAAQIGEFTYEESTAYIPEPIRSKTSAQMPPPHENIDDKIVGNTDA EKNSTPSDASSTKNTDHIV
References
External Links
ResourceLink
Saccharomyces Genome Database MEP2
Uniprot IDP41948
Uniprot NameMEP2_YEAST
GenBank Gene IDX83608
Genebank Protein ID619514
General Reference
  • Marini, A. M., Soussi-Boudekou, S., Vissers, S., Andre, B. (1997). "A family of ammonium transporters in Saccharomyces cerevisiae." Mol Cell Biol 17:4282-4293.9234685
  • Mallet, L., Bussereau, F., Jacquet, M. (1995). "A 43.5 kb segment of yeast chromosome XIV, which contains MFA2, MEP2, CAP/SRV2, NAM9, FKB1/FPR1/RBP1, MOM22 and CPT1, predicts an adenosine deaminase gene and 14 new open reading frames." Yeast 11:1195-1209.8619318
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Lorenz, M. C., Heitman, J. (1998). "The MEP2 ammonium permease regulates pseudohyphal differentiation in Saccharomyces cerevisiae." EMBO J 17:1236-1247.9482721
  • Marini, A. M., Andre, B. (2000). "In vivo N-glycosylation of the mep2 high-affinity ammonium transporter of Saccharomyces cerevisiae reveals an extracytosolic N-terminus." Mol Microbiol 38:552-564.11069679
  • Soupene, E., Ramirez, R. M., Kustu, S. (2001). "Evidence that fungal MEP proteins mediate diffusion of the uncharged species NH(3) across the cytoplasmic membrane." Mol Cell Biol 21:5733-5741.11486013
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258