You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMannose-1-phosphate guanyltransferase
Synonyms
  • ATP-mannose-1-phosphate guanylyltransferase
  • GDP-mannose pyrophosphorylase
  • NDP-hexose pyrophosphorylase
Gene NameMPG1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity
Specific FunctionInvolved in cell wall synthesis where it is required for glycosylation. Involved in cell cycle progression through cell- size checkpoint
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
D-Mannose 1-phosphate + GTP + hydronPyrophosphate + Guanosine diphosphate mannose
KEGG Reactions
GTP + hydron + D-Mannose 1-phosphatePyrophosphate + Guanosine diphosphate mannose
Metabolites
YMDB IDNameView
YMDB00202Guanosine diphosphate mannoseShow
YMDB00219PyrophosphateShow
YMDB00386D-Mannose 1-phosphateShow
YMDB00558GTPShow
YMDB00831alpha-D-mannose 1-phosphateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
catalytic activity
Process
metabolic process
biosynthetic process
Gene Properties
Chromosome LocationNot Available
LocusYDL055C
Gene Sequence>1086 bp ATGAAAGGTTTAATTTTAGTCGGTGGTTACGGTACCAGATTGAGACCTTTAACTTTGACC GTTCCAAAGCCACTGGTTGAATTCGGTAATAGACCAATGATTTTACACCAAATCGAGGCT TTAGCCAACGCTGGTGTTACTGACATCGTTCTTGCTGTTAATTACAGACCAGAAGTCATG GTGGAAACTTTGAAGAAGTACGAAAAGGAATATGGTGTTAACATCACTTTCTCTGTAGAA ACTGAACCATTAGGTACTGCAGGTCCATTGAAATTGGCTGAAGATGTTTTGAAGAAGGAC AACTCTCCATTTTTCGTCCTAAACTCCGACGTCATTTGCGAATATCCATTCAAGGAATTG GCTGACTTCCACAAAGCTCACGGTGGTAAAGGTACCATTGTTGCTACCAAGGTCGACGAA CCTTCTAAATACGGTGTCATTGTCCATGATATAGCTACTCCAAACTTGATTGACAGATTT GTTGAAAAGCCAAAGGAATTTGTTGGTAACAGAATTAACGCCGGTTTGTACATTTTAAAC CCAGAAGTCATTGACTTGATTGAAATGAAGCCAACTTCAATTGAAAAGGAAACTTTCCCA ATCTTGGTCGAAGAAAAACAACTATATTCCTTCGATTTGGAAGGTTTCTGGATGGATGTT GGTCAACCAAAGGACTTCTTGTCTGGTACCGTTCTTTACTTGAACTCTTTGGCCAAGAGA CAACCAAAAAAATTGGCTACAGGTGCCAACATTGTTGGTAATGCCTTGATCGACCCAACC GCTAAGATTTCCTCCACTGCTAAGATTGGCCCAGACGTGGTTATCGGTCCTAATGTCACC ATCGGTGATGGTGTTAGAATCACCAGATCTGTTGTTTTGTGCAACTCCACCATCAAGAAC CACTCCTTGGTCAAATCTACCATCGTAGGCTGGAACTCTACCGTTGGTCAATGGTGTCGT TTGGAAGGTGTCACTGTCTTGGGTGACGACGTTGAAGTTAAGGACGAAATCTACATCAAC GGTGGTAAAGTCTTACCTCATAAGTCTATCTCCGATAATGTTCCAAAGGAAGCTATTATT ATGTGA
Protein Properties
Pfam Domain Function
Protein Residues361
Protein Molecular Weight39565.60156
Protein Theoretical pI6.27
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mannose-1-phosphate guanyltransferase MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNSPFFVLNSDVICEYPFKEL ADFHKAHGGKGTIVATKVDEPSKYGVIVHDIATPNLIDRFVEKPKEFVGNRINAGLYILN PEVIDLIEMKPTSIEKETFPILVEEKQLYSFDLEGFWMDVGQPKDFLSGTVLYLNSLAKR QPKKLATGANIVGNALIDPTAKISSTAKIGPDVVIGPNVTIGDGVRITRSVVLCNSTIKN HSLVKSTIVGWNSTVGQWCRLEGVTVLGDDVEVKDEIYINGGKVLPHKSISDNVPKEAII M
References
External Links
ResourceLink
Saccharomyces Genome Database MPG1
Uniprot IDP41940
Uniprot NameMPG1_YEAST
GenBank Gene IDU19608
Genebank Protein ID1292898
General Reference
  • Benton, B. K., Plump, S. D., Roos, J., Lennarz, W. J., Cross, F. R. (1996). "Over-expression of S. cerevisiae G1 cyclins restores the viability of alg1 N-glycosylation mutants." Curr Genet 29:106-113.8821656
  • Hashimoto, H., Sakakibara, A., Yamasaki, M., Yoda, K. (1997). "Saccharomyces cerevisiae VIG9 encodes GDP-mannose pyrophosphorylase, which is essential for protein glycosylation." J Biol Chem 272:16308-16314.9195935
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Yoda, K., Kawada, T., Kaibara, C., Fujie, A., Abe, M., Hitoshi, Hashimoto, Shimizu, J., Tomishige, N., Noda, Y., Yamasaki, M. (2000). "Defect in cell wall integrity of the yeast saccharomyces cerevisiae caused by a mutation of the GDP-mannose pyrophosphorylase gene VIG9." Biosci Biotechnol Biochem 64:1937-1941.11055399
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956