You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione reductase
Synonyms
  • GR
  • GRase
Gene NameGLR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionMaintains high levels of reduced glutathione in the cytosol
Cellular LocationCytoplasm
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Pyruvic acid + Coenzyme A + NADAcetyl-CoA + Carbon dioxide + NADH
Pyruvic acid + Thiamine pyrophosphateCarbon dioxide + 2-(a-Hydroxyethyl)thiamine diphosphate
2-(a-Hydroxyethyl)thiamine diphosphate + Lipoamide-E ↔ Thiamine pyrophosphate + S-Acetyldihydrolipoamide-E
Coenzyme A + S-Acetyldihydrolipoamide-E ↔ Acetyl-CoA + Dihydrolipoamide-E
Oxoglutaric acid + NAD + Coenzyme ASuccinyl-CoA + NADH + hydron + Carbon dioxide
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00057Oxidized glutathioneShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00160GlutathioneShow
YMDB00175Pyruvic acidShow
YMDB00312Acetyl-CoAShow
YMDB00381Thiamine pyrophosphateShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00514Succinyl-CoAShow
YMDB00693glutathione disulfideShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
YMDB161662-(a-Hydroxyethyl)thiamine diphosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
adenyl nucleotide binding
nucleotide binding
FAD or FADH2 binding
oxidoreductase activity
catalytic activity
NADP or NADPH binding
binding
oxidoreductase activity, acting on a sulfur group of donors
disulfide oxidoreductase activity
peptide disulfide oxidoreductase activity
nucleoside binding
glutathione disulfide oxidoreductase activity
purine nucleoside binding
glutathione-disulfide reductase activity
Process
oxidation reduction
peptide metabolic process
glutathione metabolic process
cellular process
metabolic process
cellular homeostasis
cell redox homeostasis
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL091W
Gene Sequence>1452 bp ATGCTTTCTGCAACCAAACAAACATTTAGAAGTCTACAGATAAGAACTATGTCCACGAAC ACCAAGCATTACGATTACCTCGTCATCGGGGGTGGCTCAGGGGGTGTTGCTTCCGCAAGA AGAGCTGCATCTTATGGTGCGAAGACATTACTAGTTGAAGCTAAGGCTCTTGGTGGTACC TGTGTTAACGTGGGTTGTGTTCCGAAGAAAGTCATGTGGTATGCTTCTGACCTCGCTACT AGAGTATCCCATGCAAATGAATATGGATTATATCAGAATCTTCCATTAGATAAAGAGCAT TTGACTTTTAATTGGCCAGAATTTAAGCAGAAAAGGGATGCTTATGTCCATAGGTTGAAC GGTATATACCAGAAGAATTTAGAAAAAGAAAAAGTGGATGTTGTATTTGGATGGGCTAGA TTCAATAAGGACGGTAATGTTGAAGTTCAGAAAAGGGATAATACTACTGAAGTTTACTCC GCTAACCATATTTTAGTTGCGACCGGTGGAAAGGCTATTTTCCCCGAAAACATTCCAGGT TTCGAATTAGGTACTGATTCTGATGGGTTCTTTAGATTGGAAGAACAACCTAAGAAAGTT GTTGTTGTTGGCGCTGGTTATATTGGTATTGAGCTAGCAGGTGTGTTCCATGGGCTGGGA TCCGAAACGCACTTGGTAATTAGAGGTGAAACTGTCTTGAGAAAATTTGATGAATGCATC CAGAACACTATTACTGACCATTACGTAAAGGAAGGCATCAACGTTCATAAACTATCCAAA ATTGTTAAGGTGGAGAAAAATGTAGAAACTGACAAACTGAAAATACATATGAATGACTCA AAGTCCATCGATGACGTTGACGAATTAATTTGGACAATTGGACGTAAATCCCATCTAGGT ATGGGTTCAGAAAATGTAGGTATAAAGCTGAACTCTCATGACCAAATAATTGCTGATGAA TATCAGAACACCAATGTTCCAAACATTTATTCTCTAGGTGACGTTGTTGGAAAAGTTGAA TTGACACCTGTCGCTATTGCAGCGGGCAGAAAGCTGTCTAATAGACTGTTTGGTCCAGAG AAATTCCGTAATGACAAACTAGATTACGAGAACGTCCCCAGCGTAATTTTCTCACATCCT GAAGCCGGTTCCATTGGTATTTCTGAGAAGGAAGCCATTGAAAAGTACGGTAAGGAGAAT ATAAAGGTCTACAATTCCAAATTTACCGCCATGTACTATGCTATGTTGAGTGAGAAATCA CCCACAAGATATAAAATTGTTTGTGCGGGACCAAATGAAAAGGTTGTCGGTCTGCACATT GTTGGTGATTCCTCTGCAGAAATCTTGCAAGGGTTCGGTGTTGCTATAAAGATGGGTGCC ACTAAGGCTGATTTCGATAATTGTGTTGCTATTCATCCGACTAGCGCAGAAGAATTGGTT ACTATGAGATGA
Protein Properties
Pfam Domain Function
Protein Residues483
Protein Molecular Weight53440.60156
Protein Theoretical pI7.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione reductase MLSATKQTFRSLQIRTMSTNTKHYDYLVIGGGSGGVASARRAASYGAKTLLVEAKALGGT CVNVGCVPKKVMWYASDLATRVSHANEYGLYQNLPLDKEHLTFNWPEFKQKRDAYVHRLN GIYQKNLEKEKVDVVFGWARFNKDGNVEVQKRDNTTEVYSANHILVATGGKAIFPENIPG FELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRKFDECI QNTITDHYVKEGINVHKLSKIVKVEKNVETDKLKIHMNDSKSIDDVDELIWTIGRKSHLG MGSENVGIKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPE KFRNDKLDYENVPSVIFSHPEAGSIGISEKEAIEKYGKENIKVYNSKFTAMYYAMLSEKS PTRYKIVCAGPNEKVVGLHIVGDSSAEILQGFGVAIKMGATKADFDNCVAIHPTSAEELV TMR
References
External Links
ResourceLink
Saccharomyces Genome Database GLR1
Uniprot IDP41921
Uniprot NameGSHR_YEAST
GenBank Gene IDU43281
Genebank Protein ID1151235
General Reference
  • Collinson, L. P., Dawes, I. W. (1995). "Isolation, characterization and overexpression of the yeast gene, GLR1, encoding glutathione reductase." Gene 156:123-127.7737505
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956