You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeroxisomal long-chain fatty acid import protein 2
Synonyms
  • Peroxisomal ABC transporter 1
Gene NamePXA1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionInvolved in the import of activated long-chain fatty acids from the cytosol to the peroxisomal matrix
Cellular LocationPeroxisome membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00682stearic acidShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
primary active transmembrane transporter activity
binding
P-P-bond-hydrolysis-driven transmembrane transporter activity
nucleoside binding
ATPase activity, coupled to transmembrane movement of substances
purine nucleoside binding
pyrophosphatase activity
adenyl nucleotide binding
nucleoside-triphosphatase activity
adenyl ribonucleotide binding
ATPase activity
ATP binding
nucleotide binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 16
LocusYPL147W
Gene Sequence>2613 bp ATGTCAACAACATTAGCAGCACCAGCGAAACTAAAGAGTTTGCTCCTGAATCTACATACT CACTGTATTGGGCTACACGTTAACGATGTCACACCTAAAGTATATTTCAAGTTATTGATA CGGCATCTTCTACAGATATCTAGATCAAACGCTGCTCATCCTAAGCTAAGAAGAAGGGCC CAGATTTTATTGGTATCGCTTTTCCTATCTGGTGTCACACTTTTTTCTGGTGTAACATAT AGTACTTTCAAAATTATTCTAAAATGTTATAAATTTTACAAGTTTCCATGGAAGAGAAGG AATAGGAGACCTTTAATAAGAAGAACAAGATCTCAAATGCAATTAGACAGTGGTGCAAGA ATAATGTATATTCCTGAAGTGGAATTAGTCGACCGCCAGAGTCCCGATGACAACAAATTT ATGAATGCTACAGATAAAAAAAAAAGGAAAAGGATATTTATTCCACCAAAGGATAACGAT GTATATGAACACGATAAGTTTCTTTTTAAAAATGTAGAACTGGAAAGAGCCAAGAATTCG CAGTTATTCTACTCAAAATTTTTAAACCAAATGAACGTCTTGTCTAAAATTTTAATTCCA ACAGTTTTTGACAAAAACTTTCTTCTTTTAACTGCTCAAATTTTTTTCCTGGTGATGAGA ACTTGGCTCTCTTTGTTTGTAGCCAAGCTGGATGGACAAATAGTCAAAAATATAATTGCT GGTAGAGGAAGAAGCTTTCTGTGGGACTTAGGGTGTTGGTTTTTAATTGCTGTCCCTGCT TCTTATACTAATAGTGCTATTAAGCTACTTCAAAGGAAGTTGAGTTTAAACTTTAGGGTA AATTTGACACGTTACATCCATGACATGTATTTGGATAAAAGACTAACATTTTACAAATTA ATTTTTGATGCAAAGGCGTCCAATTCGGTAATCAAGAATATCGACAACTCCATTACTAAT GATGTTGCAAAATTTTGCGATGCGACATGCTCCGTTTTTGCAAACATTGCAAAGCCAGTT ATTGATTTAATATTCTTTTCGGTTTATTTACGTGATAATTTGGGAACTGTGGGAGTAGCA GGTATATTTGTTAATTATTTCATTACTGGGTTTATTTTGAGGAAATACACGCCACCATTA GGTAAATTGGCAGGCGAGAGATCTGCTTCAGACGGCGATTACTACAATTATCATCTAAAC ATGATAAATAATAGCGAAGAGATCGCATTTTACCAAGGAACAGCAGTGGAAAGGACGAAA GTTAAAGAGTTGTATGATGTGCTGATGGAAAAAATGCTGCTGGTTGATAAAGTCAAGTTT GGTTACAATATGTTGGAAGACTATGTTTTAAAATATACATGGTCCGGTTTGGGTTATGTT TTTGCCTCAATCCCTATCGTTATGTCTACCTTAGCGACAGGCATCAATTCAGAGGAAAAA AATATGAAGGAATTTATAGTCAACAAAAGGTTGATGTTGTCGCTTGCAGATGCAGGCTCG AGATTGATGCATTCGATAAAGGACATCTCACAATTGACCGGCTACACTAATAGGATATTT ACTCTGCTTTCCGTCTTACACAGGGTTCACTCTCTGAACTTTAATTACGGCGCTGTTCCT TCAATCCTGTCAATACGTACAGAAGACGCTTCCAGAAATTCCAACTTATTACCCACCACG GATAATTCGCAAGATGCTATTCGTGGTACTATTCAACGCAATTTTAACGGTATTCGGTTA GAAAATATAGACGTAATCATTCCATCAGTAAGGGCGAGCGAAGGCATAAAGCTGATTAAC AAGCTTACATTTCAAATTCCTTTGCATATTGACCCAATAACTTCAAAGTCCAATTCTATA CAAGACTTATCGAAGGCAAATGATATAAAGTTACCATTTTTGCAGGGTTCTGGCTCCAGC CTGTTAATATTAGGGCCAAATGGTTGCGGTAAAAGTTCAATTCAACGCATTATAGCTGAA ATATGGCCAGTGTATAACAAAAATGGATTATTGTCGATTCCTTCAGAAAATAATATTTTT TTTATTCCTCAGAAACCATATTTTAGTAGAGGTGGAACTTTAAGAGACCAAATTATATAC CCCATGTCCTCGGATGAATTCTTTGATAGGGGGTTTAGAGATAAGGAGCTAGTACAGATA TTAGTCGAAGTGAAACTAGATTATCTTTTAAAAAGAGGCGTTGGCTTAACTTACCTAGAT GCCATTGCCGATTGGAAGGACTTATTAAGTGGTGGTGAAAAGCAAAGAGTAAATTTTGCT AGAATCATGTTTCATAAACCACTATACGTAGTATTAGATGAGGCTACAAACGCAATTAGT GTTGACATGGAAGACTATCTGTTCAATCTTTTAAAACGATACAGATTCAATTTCATTTCC ATATCACAAAGACCCACATTAATCAAATATCATGAAATGTTACTAGAGATCGGTGAAAAT CGAGATGGCAAATGGCAATTACAGGCAGTTGGTACCGATGAAGCAATCACGTCGATTGAC AACGAGATTGAGGAATTGGAGAGAAAACTAGAAAGAGTAAAAGGTTGGGAAGATGAGAGG ACGAAGCTACGGGAAAAGCTTGAAATTATTTGA
Protein Properties
Pfam Domain Function
Protein Residues870
Protein Molecular Weight100024.0
Protein Theoretical pI10.0
Signalling Regions
  • None
Transmembrane Regions
  • 60-80
  • 207-227
  • 247-267
  • 330-350
  • 353-373
  • 455-475
Protein Sequence>Peroxisomal long-chain fatty acid import protein 2 MSTTLAAPAKLKSLLLNLHTHCIGLHVNDVTPKVYFKLLIRHLLQISRSNAAHPKLRRRA QILLVSLFLSGVTLFSGVTYSTFKIILKCYKFYKFPWKRRNRRPLIRRTRSQMQLDSGAR IMYIPEVELVDRQSPDDNKFMNATDKKKRKRIFIPPKDNDVYEHDKFLFKNVELERAKNS QLFYSKFLNQMNVLSKILIPTVFDKNFLLLTAQIFFLVMRTWLSLFVAKLDGQIVKNIIA GRGRSFLWDLGCWFLIAVPASYTNSAIKLLQRKLSLNFRVNLTRYIHDMYLDKRLTFYKL IFDAKASNSVIKNIDNSITNDVAKFCDATCSVFANIAKPVIDLIFFSVYLRDNLGTVGVA GIFVNYFITGFILRKYTPPLGKLAGERSASDGDYYNYHLNMINNSEEIAFYQGTAVERTK VKELYDVLMEKMLLVDKVKFGYNMLEDYVLKYTWSGLGYVFASIPIVMSTLATGINSEEK NMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLLSVLHRVHSLNFNYGAVP SILSIRTEDASRNSNLLPTTDNSQDAIRGTIQRNFNGIRLENIDVIIPSVRASEGIKLIN KLTFQIPLHIDPITSKSNSIQDLSKANDIKLPFLQGSGSSLLILGPNGCGKSSIQRIIAE IWPVYNKNGLLSIPSENNIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQI LVEVKLDYLLKRGVGLTYLDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAIS VDMEDYLFNLLKRYRFNFISISQRPTLIKYHEMLLEIGENRDGKWQLQAVGTDEAITSID NEIEELERKLERVKGWEDERTKLREKLEII
References
External Links
ResourceLink
Saccharomyces Genome Database PXA1
Uniprot IDP41909
Uniprot NamePXA1_YEAST
GenBank Gene IDL38491
Genebank Protein ID1063413
General Reference
  • Shani, N., Watkins, P. A., Valle, D. (1995). "PXA1, a possible Saccharomyces cerevisiae ortholog of the human adrenoleukodystrophy gene." Proc Natl Acad Sci U S A 92:6012-6016.7597071
  • Swartzman, E. E., Viswanathan, M. N., Thorner, J. (1996). "The PAL1 gene product is a peroxisomal ATP-binding cassette transporter in the yeast Saccharomyces cerevisiae." J Cell Biol 132:549-563.8647887
  • Purnelle, B., Coster, F., Goffeau, A. (1996). "The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators." Yeast 12:1483-1492.8948103
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hettema, E. H., van Roermund, C. W., Distel, B., van den Berg, M., Vilela, C., Rodrigues-Pousada, C., Wanders, R. J., Tabak, H. F. (1996). "The ABC transporter proteins Pat1 and Pat2 are required for import of long-chain fatty acids into peroxisomes of Saccharomyces cerevisiae." EMBO J 15:3813-3822.8670886