Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeroxisomal acyl-coenzyme A thioester hydrolase 1
Synonyms
  • Peroxisomal long-chain acyl-CoA thioesterase 1
Gene NameTES1
Enzyme Class
Biological Properties
General FunctionInvolved in acyl-CoA thioesterase activity
Specific FunctionAcyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH
Cellular LocationPeroxisome
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
SMPDB Reactions
stearoyl-CoA + waterhydron + Coenzyme A + stearic acid
KEGG Reactions
decanoyl-CoA + watercapric acid + hydron + Coenzyme A
water + lauroyl-CoAlauric acid + hydron + Coenzyme A
water + Tetracosanoyl-CoA lignoceric acid + hydron + Coenzyme A
Palmityl-CoA + waterhydron + Coenzyme A + Palmitic acid
water + Tetradecanoyl-CoA myristic acid + hydron + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00069Palmitic acidShow
YMDB00301Palmityl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00528myristoyl-CoAShow
YMDB00530lauroyl-CoAShow
YMDB00531octanoyl-CoAShow
YMDB00532decanoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00676Caprylic acidShow
YMDB00677capric acidShow
YMDB00678lauric acidShow
YMDB00679myristic acidShow
YMDB00682stearic acidShow
YMDB00684lignoceric acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00909Tetracosanoyl-CoA Show
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
thiolester hydrolase activity
CoA hydrolase activity
acyl-CoA thioesterase activity
catalytic activity
Process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
acyl-CoA metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJR019C
Gene Sequence>1050 bp ATGAGTGCTTCCAAAATGGCCATGTCCAACCTAGAGAAAATATTGGAACTGGTTCCTCTT TCGCCTACCAGTTTTGTCACAAAGTATCTGCCTGCCGCGCCCGTAGGGTCTAAGGGCACT TTTGGTGGAACGCTGGTATCACAATCGCTGCTGGCGTCATTGCATACTGTGCCATTGAAC TTCTTCCCCACATCGCTACATTCGTATTTCATCAAGGGTGGTGATCCGCGGACCAAGATC ACGTACCATGTGCAGAATCTGAGAAACGGTAGAAATTTCATCCATAAGCAGGTTAGTGCT TATCAGCACGACAAGTTGATATTTACGTCGATGATCTTATTTGCCGTGCAACGGTCCAAG GAGCACGACTCCTTGCAGCACTGGGAGACGATTCCAGGCCTGCAAGGTAAGCAGCCAGAC CCTCATCGTTATGAAGAGGCCACTTCGCTTTTCCAGAAAGAAGTTCTGGACCCACAGAAA TTGAGCAGGTATGCCTCATTGTCCGACAGGTTCCAAGACGCAACCTCGATGAGCAAGTAT GTGGATGCGTTTCAATACGGAGTCATGGAGTACCAATTCCCCAAGGACATGTTCTACTCG GCAAGACACACCGACGAGCTGGATTATTTCGTCAAAGTGAGACCTCCCATCACTACCGTG GAGCACGCGGGCGACGAGTCTTCTTTACACAAGCATCATCCGTACAGGATCCCGAAGAGC ATTACTCCTGAGAACGACGCTCGCTACAACTACGTGGCCTTTGCGTATCTGTCCGATTCC TACCTCCTACTCACGATCCCGTACTTCCACAACCTGCCTTTGTACTGCCACAGTTTCAGT GTCTCGCTCGACCACACGATTTACTTTCACCAGTTGCCTCATGTGAACAATTGGATCTAT CTTAAGATTTCGAATCCCAGGTCCCACTGGGACAAGCACCTCGTACAGGGCAAGTATTTC GACACACAGTCGGGACGCATCATGGCAAGCGTCTCTCAGGAGGGCTACGTTGTCTACGGG TCAGAACGAGACATTCGAGCCAAGTTCTGA
Protein Properties
Pfam Domain Function
Protein Residues349
Protein Molecular Weight40259.39844
Protein Theoretical pI9.1
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peroxisomal acyl-coenzyme A thioester hydrolase 1 MSASKMAMSNLEKILELVPLSPTSFVTKYLPAAPVGSKGTFGGTLVSQSLLASLHTVPLN FFPTSLHSYFIKGGDPRTKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMILFAVQRSK EHDSLQHWETIPGLQGKQPDPHRYEEATSLFQKEVLDPQKLSRYASLSDRFQDATSMSKY VDAFQYGVMEYQFPKDMFYSARHTDELDYFVKVRPPITTVEHAGDESSLHKHHPYRIPKS ITPENDARYNYVAFAYLSDSYLLLTIPYFHNLPLYCHSFSVSLDHTIYFHQLPHVNNWIY LKISNPRSHWDKHLVQGKYFDTQSGRIMASVSQEGYVVYGSERDIRAKF
References
External Links
ResourceLink
Saccharomyces Genome Database TES1
Uniprot IDP41903
Uniprot NamePTE1_YEAST
GenBank Gene IDAF124265
Genebank Protein ID4680315
General Reference
  • Jones, J. M., Nau, K., Geraghty, M. T., Erdmann, R., Gould, S. J. (1999). "Identification of peroxisomal acyl-CoA thioesterases in yeast and humans." J Biol Chem 274:9216-9223.10092594
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269