You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameValine amino-acid permease
Synonyms
  • Branched-chain amino-acid permease 3
Gene NameBAP3
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionInvolved in transport of isoleucine, leucine, valine, cysteine, methionine, phenylalanine, tyrosine and tryptophan
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00046L-CysteineShow
YMDB00126L-TryptophanShow
YMDB00152L-ValineShow
YMDB00154L-AlanineShow
YMDB00214L-ThreonineShow
YMDB00304L-PhenylalanineShow
YMDB00318L-MethionineShow
YMDB00364L-TyrosineShow
YMDB00387L-LeucineShow
YMDB00862hydronShow
GO Classification
Component
integral to membrane
cell part
membrane
membrane part
intrinsic to membrane
Function
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
amino acid transmembrane transporter activity
Process
transport
amine transport
amino acid transport
transmembrane transport
establishment of localization
Gene Properties
Chromosome Locationchromosome 4
LocusYDR046C
Gene Sequence>1815 bp ATGTCAGATCCTATAGTAACGTCTTCCAAAATGGAAAAAAGTGCAGAGTTTGAAGTAACA GACTCTGCTTTATATAATAACTTCAATACATCAACAACAGCTTCACTAACTCCGGAGATT AAGGAACATTCTGAGGAATCTCGCAATGGGTTAGTTCACAGATTCGTCGACTCATTCAGA AGAGCCGAAAGCCAACGTTTAGAAGAAGACAATGACTTGGAGGATGGTACCAAATCGATG AAATCTAATAACCACTTAAAAAAGTCAATGAAATCTAGACATGTTGTAATGATGTCTTTA GGTACAGGGATAGGAACAGGTCTTCTAGTTGCCAACGCCAAAGGTTTGAGTCTTGCAGGC CCGGGGTCTTTAGTCATCGGTTACGTTATGGTGTCCTTCGTCACGTATTTTATGGTCCAA GCGGCTGGTGAGATGGGTGTCACTTATCCGACGCTTCCAGGTAACTTCAATGCATACAAT TCAATCTTTATTTCAAAGTCGTTTGGGTTCGCGACCACTTGGTTATTTTGCATTCAGTGG TTAACTGTGCTACCGTTGGAATTGATTACTTCTTCCATGACCGTCAAGTACTGGAATGAC ACAATTAATGCTGATGTATTCATTGTCATTTTCTATGTGTTTTTATTGTTTATCCACTTT TTTGGTGTTAAGGCATACGGTGAAACGGAATTTATCTTCAATTCCTGTAAGATATTGATG GTTGCAGGATTCATTATTTTATCAGTCGTCATCAATTGTGGGGGAGCCGGTGTGGACGGC TATATTGGCGGCAAATATTGGCGCGACCCTGGTTCATTTGCAGAAGGCAGCGGTGCCACT CGTTTCAAAGGGATATGTTATATTCTAGTATCTGCATATTTCTCCTTCGGTGGTATTGAA TTATTTGTTCTTTCCATCAATGAGCAGTCTAACCCTAGAAAATCCACTCCTGTAGCCGCG AAGAGAAGTGTATATCGTATTTTGATCATTTATTTGCTGACAATGATTCTAATTGGGTTC AATGTTCCTCACAATAACGATCAATTGATGGGTTCCGGTGGCTCCGCAACGCACGCTTCA CCATATGTCTTGGCAGCCTCTATTCACAAGGTTAGGGTCATCCCCCATATCATTAATGCT GTTATTTTGATATCAGTCATCTCTGTTGCGAACTCTGCCCTTTATGCCGCACCGAGATTA ATGTGTTCCTTGGCTCAACAGGGCTATGCTCCAAAATTTTTGAACTATATTGATAGGGAG GGAAGACCTTTAAGGGCCTTGGTAGTGTGCTCTCTTGTTGGTGTCGTTGGCTTCGTCGCC TGTTCTCCACAGGAAGAGCAAGCATTTACATGGTTGGCAGCCATTGCAGGTTTGAGTGAA CTTTTCACATGGTCAGGCATTATGCTTTCACACATTCGATTCAGAAAAGCGATGAAAGTC CAAGGAAGATCACTTGATGAAGTCGGCTATAAGGCCAATACCGGTATATGGGGTTCATAC TATGGGGTTTTTTTCAATATGCTTGTCTTTATGGCCCAATTTTGGGTCGCACTGTCTCCA ATAGGAAATGGCGGAAAGTGTGATGCTCAGGCATTCTTCGAGAGTTATCTGGCTGCCCCG CTATGGATATTCATGTATGTTGGATACATGGTTTACAAAAGAGATTTTACCTTTTTAAAC CCACTGGACAAGATCGACTTGGACTTTCATAGAAGAGTTTACGACCCTGAAATAATGAGG CAGGAGGACGAAGAAAATAAAGAAAGGTTAAAGAACTCTTCAATATTCGTCAGAGTCTAC AAATTTTGGTGTTAG
Protein Properties
Pfam Domain Function
Protein Residues604
Protein Molecular Weight67364.39844
Protein Theoretical pI8.28
Signalling Regions
  • None
Transmembrane Regions
  • 96-116
  • 120-140
  • 170-190
  • 207-227
  • 239-259
  • 285-305
  • 324-344
  • 378-398
  • 424-444
  • 450-470
  • 503-523
  • 532-552
Protein Sequence>Valine amino-acid permease MSDPIVTSSKMEKSAEFEVTDSALYNNFNTSTTASLTPEIKEHSEESRNGLVHRFVDSFR RAESQRLEEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAG PGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQW LTVLPLELITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILM VAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAEGSGATRFKGICYILVSAYFSFGGIE LFVLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHAS PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDRE GRPLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKV QGRSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNGGKCDAQAFFESYLAAP LWIFMYVGYMVYKRDFTFLNPLDKIDLDFHRRVYDPEIMRQEDEENKERLKNSSIFVRVY KFWC
References
External Links
ResourceLink
Saccharomyces Genome Database BAP3
Uniprot IDP41815
Uniprot NameBAP3_YEAST
GenBank Gene IDZ49209
Genebank Protein ID798899
General Reference
  • Mai, B., Lipp, M. (1994). "Cloning and chromosomal organization of a gene encoding a putative amino-acid permease from Saccharomyces cerevisiae." Gene 143:129-133.8200527
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • During-Olsen, L., Regenberg, B., Gjermansen, C., Kielland-Brandt, M. C., Hansen, J. (1999). "Cysteine uptake by Saccharomyces cerevisiae is accomplished by multiple permeases." Curr Genet 35:609-617.10467005
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258