You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsoamyl acetate-hydrolyzing esterase
SynonymsNot Available
Gene NameIAH1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionPlays a crucial role in the hydrolysis of isoamyl acetate in sake mash
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + Ethyl acetateEthanol + Acetic acid + hydron
isoamyl acetate + waterAcetic acid + isoamylol + hydron
isobutyl acetate + waterAcetic acid + isobutanol + hydron
Metabolites
YMDB IDNameView
YMDB00056Acetic acidShow
YMDB00569Ethyl acetateShow
YMDB00570isoamylolShow
YMDB00571isoamyl acetateShow
YMDB00572isobutyl acetateShow
YMDB00573isobutanolShow
YMDB00862hydronShow
YMDB00883EthanolShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
catalytic activity
Process
primary metabolic process
lipid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR126C
Gene Sequence>717 bp ATGGATTACGAGAAGTTTCTGTTATTTGGGGATTCCATTACTGAATTTGCTTTTAATACT AGGCCCATTGAAGATGGCAAAGATCAGTATGCTCTTGGAGCCGCATTAGTCAACGAATAT ACGAGAAAAATGGATATTCTTCAAAGAGGGTTCAAAGGGTACACTTCTAGATGGGCGTTG AAAATACTTCCTGAGATTTTAAAGCATGAATCCAATATTGTCATGGCCACAATATTTTTG GGTGCCAACGATGCATGCTCAGCAGGTCCCCAAAGTGTCCCCCTCCCCGAATTTATCGAT AATATTCGTCAAATGGTATCTTTGATGAAGTCTTACCATATCCGTCCTATTATAATAGGA CCGGGGCTAGTAGATAGAGAGAAGTGGGAAAAAGAAAAATCTGAAGAAATAGCTCTCGGA TACTTCCGTACCAACGAGAACTTTGCCATTTATTCCGATGCCTTAGCAAAACTAGCCAAT GAGGAAAAAGTTCCCTTCGTGGCTTTGAATAAGGCGTTTCAACAGGAAGGTGGTGATGCT TGGCAACAACTGCTAACAGATGGACTGCACTTTTCCGGAAAAGGGTACAAAATTTTTCAT GACGAATTATTGAAGGTCATTGAGACATTCTACCCCCAATATCATCCCAAAAACATGCAG TACAAACTGAAAGATTGGAGAGATGTGCTAGATGATGGATCTAACATAATGTCTTGA
Protein Properties
Pfam Domain Function
Protein Residues238
Protein Molecular Weight27346.0
Protein Theoretical pI5.4
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isoamyl acetate-hydrolyzing esterase MDYEKFLLFGDSITEFAFNTRPIEDGKDQYALGAALVNEYTRKMDILQRGFKGYTSRWAL KILPEILKHESNIVMATIFLGANDACSAGPQSVPLPEFIDNIRQMVSLMKSYHIRPIIIG PGLVDREKWEKEKSEEIALGYFRTNENFAIYSDALAKLANEEKVPFVALNKAFQQEGGDA WQQLLTDGLHFSGKGYKIFHDELLKVIETFYPQYHPKNMQYKLKDWRDVLDDGSNIMS
References
External Links
ResourceLink
Saccharomyces Genome Database IAH1
Uniprot IDP41734
Uniprot NameIAH1_YEAST
GenBank Gene IDAY557754
Genebank Protein ID45269399
General Reference
  • Wiemann, S., Rechmann, S., Benes, V., Voss, H., Schwager, C., Vlcek, C., Stegemann, J., Zimmermann, J., Erfle, H., Paces, V., Ansorge, W. (1996). "Sequencing and analysis of 51 kb on the right arm of chromosome XV from Saccharomyces cerevisiae reveals 30 open reading frames." Yeast 12:281-288.8904341
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Fukuda, K., Kiyokawa, Y., Yanagiuchi, T., Wakai, Y., Kitamoto, K., Inoue, Y., Kimura, A. (2000). "Purification and characterization of isoamyl acetate-hydrolyzing esterase encoded by the IAH1 gene of Saccharomyces cerevisiae from a recombinant Escherichia coli." Appl Microbiol Biotechnol 53:596-600.10855721