Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name(DL)-glycerol-3-phosphatase 1
Synonyms
  • Related to HOR2 protein 2
Gene NameRHR2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionGlycerol 3-phosphate + H(2)O = glycerol + phosphate
Cellular LocationCytoplasm
SMPDB Pathways
Glycerol metabolismPW002407 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG PathwaysNot Available
SMPDB Reactions
water + Glycerol 3-phosphate Glycerol + phosphate
KEGG Reactions
Glycerol 3-phosphate + waterGlycerol + phosphate
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00283GlycerolShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL053W
Gene Sequence>753 bp ATGCCTTTGACCACAAAACCTTTATCTTTGAAAATCAACGCCGCTCTATTCGATGTTGAC GGTACCATCATCATCTCTCAACCAGCCATTGCTGCTTTCTGGAGAGATTTCGGTAAAGAC AAGCCTTACTTCGATGCCGAACACGTTATTCACATCTCTCACGGTTGGAGAACTTACGAT GCCATTGCCAAGTTCGCTCCAGACTTTGCTGATGAAGAATACGTTAACAAGCTAGAAGGT GAAATCCCAGAAAAGTACGGTGAACACTCCATCGAAGTTCCAGGTGCTGTCAAGTTGTGT AATGCTTTGAACGCCTTGCCAAAGGAAAAATGGGCTGTCGCCACCTCTGGTACCCGTGAC ATGGCCAAGAAATGGTTCGACATTTTGAAGATCAAGAGACCAGAATACTTCATCACCGCC AATGATGTCAAGCAAGGTAAGCCTCACCCAGAACCATACTTAAAGGGTAGAAACGGTTTG GGTTTCCCAATTAATGAACAAGACCCATCCAAATCTAAGGTTGTTGTCTTTGAAGACGCA CCAGCTGGTATTGCTGCTGGTAAGGCTGCTGGCTGTAAAATCGTTGGTATTGCTACCACT TTCGATTTGGACTTCTTGAAGGAAAAGGGTTGTGACATCATTGTCAAGAACCACGAATCT ATCAGAGTCGGTGAATACAACGCTGAAACCGATGAAGTCGAATTGATCTTTGATGACTAC TTATACGCTAAGGATGACTTGTTGAAATGGTAA
Protein Properties
Pfam Domain Function
Protein Residues250
Protein Molecular Weight27946.59961
Protein Theoretical pI5.22
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>(DL)-glycerol-3-phosphatase 1 MPLTTKPLSLKINAALFDVDGTIIISQPAIAAFWRDFGKDKPYFDAEHVIHISHGWRTYD AIAKFAPDFADEEYVNKLEGEIPEKYGEHSIEVPGAVKLCNALNALPKEKWAVATSGTRD MAKKWFDILKIKRPEYFITANDVKQGKPHPEPYLKGRNGLGFPINEQDPSKSKVVVFEDA PAGIAAGKAAGCKIVGIATTFDLDFLKEKGCDIIVKNHESIRVGEYNAETDEVELIFDDY LYAKDDLLKW
References
External Links
ResourceLink
Saccharomyces Genome Database RHR2
Uniprot IDP41277
Uniprot NameGPP1_YEAST
GenBank Gene IDD50471
Genebank Protein ID1236750
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Norbeck, J., Pahlman, A. K., Akhtar, N., Blomberg, A., Adler, L. (1996). "Purification and characterization of two isoenzymes of DL-glycerol-3-phosphatase from Saccharomyces cerevisiae. Identification of the corresponding GPP1 and GPP2 genes and evidence for osmotic regulation of Gpp2p expression by the osmosensing mitogen-activated protein kinase signal transduction pathway." J Biol Chem 271:13875-13881.8662716
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Zhou, W., Ryan, J. J., Zhou, H. (2004). "Global analyses of sumoylated proteins in Saccharomyces cerevisiae. Induction of protein sumoylation by cellular stresses." J Biol Chem 279:32262-32268.15166219
  • Hirayama, T., Maeda, T., Saito, H., Shinozaki, K. (1995). "Cloning and characterization of seven cDNAs for hyperosmolarity-responsive (HOR) genes of Saccharomyces cerevisiae." Mol Gen Genet 249:127-138.7500933
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Norbeck, J., Blomberg, A. (1997). "Metabolic and regulatory changes associated with growth of Saccharomyces cerevisiae in 1.4 M NaCl. Evidence for osmotic induction of glycerol dissimilation via the dihydroxyacetone pathway." J Biol Chem 272:5544-5554.9038161
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956