Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name1,3-beta-glucan synthase component GSC2
Synonyms
  • 1,3-beta-D-glucan-UDP glucosyltransferase
  • FK506 sensitivity protein 2
  • Glucan synthase of cerevisiae protein 2
Gene NameGSC2
Enzyme Class
Biological Properties
General FunctionInvolved in 1,3-beta-D-glucan synthase activity
Specific FunctionAlternate catalytic subunit of the 1,3-beta-glucan synthase (GS). Synthesizes 1,3-beta-glucan, a major structural component of the yeast cell wall. Required for spore wall assembly. Negative regulation of activity by SMK1 is important for spore wall deposition. Activity is positively regulated by RHO1
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: cell wall stress test 1PW007861 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
1,3-beta-D-Glucan + Uridine 5'-diphosphateUridine diphosphate glucose + 1,3-beta-D-Glucan
KEGG Reactions
Uridine diphosphate glucoseUridine 5'-diphosphate + (1->3)-beta-D-glucan + hydron
Metabolites
YMDB IDNameView
YMDB00212Uridine diphosphate glucoseShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00862hydronShow
YMDB163141,3-beta-D-GlucanShow
GO Classification
Component
macromolecular complex
1,3-beta-glucan synthase complex
protein complex
cell part
membrane
Function
UDP-glycosyltransferase activity
catalytic activity
UDP-glucosyltransferase activity
transferase activity
1,3-beta-glucan synthase activity
transferase activity, transferring glycosyl groups
Process
1,3-beta-glucan biosynthetic process
polysaccharide metabolic process
metabolic process
glucan metabolic process
cellular glucan metabolic process
beta-glucan metabolic process
primary metabolic process
1,3-beta-glucan metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR032W
Gene Sequence>5688 bp ATGTCCTACAACGATCCAAACTTGAATGGACAGTATTACAGTAACGGTGATGGGACTGGT GACGGTAATTACCCTACGTACCAAGTGACACAGGATCAAAGTGCGTACGATGAGTACGGT CAGCCAATCTATACACAAAACCAACTGGATGATGGTTATTATGATCCAAACGAACAATAC GTTGACGGTACACAATTTCCTCAGGGACAAGATCCTTCACAAGACCAAGGTCCTTATAAT AACGATGCTAGTTACTATAACCAACCCCCCAATATGATGAACCCGTCTTCTCAAGATGGA GAGAACTTCTCAGATTTTAGCAGCTATGGTCCCCCATCCGGCACTTATCCTAACGATCAA TATACTCCTTCTCAAATGAGTTATCCTGATCAAGATGGTTCTTCAGGGACCTCAACCCCC TATGGAAATGGTGTCGTTAATGGTAATGGCCAGTACTACGACCCTAATGCTATTGAAATG GCTTTACCAAATGATCCATATCCCGCATGGACCGCAGATCCCCAGTCTCCCCTGCCCATC GAACAAATCGAAGATATCTTCATAGATTTAACAAATAAATTCGGTTTTCAGAGAGATTCC ATGAGAAATATGTTTGACCATTTTATGACCCTTTTGGACTCTAGATCTTCTAGGATGTCT CCAGAACAGGCCCTTTTATCATTACATGCAGACTACATAGGTGGAGATACGGCCAACTAC AAAAAATGGTACTTTGCCGCTCAACTTGATATGGATGATGAAATTGGTTTCAGGAATATG GAGTTGGGTAAGCTATCAAGAAAGGCAAGAAAGGCTAAGAAGAGAAATAAAAAAGCCATG CAAGAGGCTAGTCCTGAAGACACTGAGGAGACTTTAAATCAAATTGAGGGTGATAACTCA TTAGAAGCTGCGGATTTTAGATGGAAGTCAAAGATGAATCAACTTTCTCCATTTGAAATG GTTCGGCAAATTGCCTTGTTTTTATTATGTTGGGGCGAGGCAAATCAAGTCAGATTTACC CCGGAGTGTCTTTGTTTCATTTATAAATGCGCCTCTGATTACTTAGATTCTGCACAATGT CAACAACGTCCTGATCCCTTGCCTGAAGGTGATTTTTTGAATAGAGTTATTACTCCTCTT TATCGTTTTATTAGGAGCCAGGTTTACGAAATCGTGGATGGTCGATACGTGAAGAGTGAA AAAGATCATAACAAAGTTATTGGGTATGATGATGTCAATCAATTATTCTGGTATCCAGAA GGTATAGCAAAAATTGTCATGGAAGATGGAACCAGGTTGATTGATTTGCCAGCAGAGGAG CGTTATTTGAAATTGGGAGAAATTCCCTGGGATGATGTCTTCTTTAAAACTTACAAAGAA ACACGTTCCTGGTTACATTTAGTTACCAACTTCAATCGTATTTGGATCATGCACATCTCA GTATATTGGATGTATTGTGCTTACAATGCTCCAACTTTTTATACTCACAACTATCAACAA TTGGTCGACAATCAGCCTTTGGCAGCTTATAAATGGGCCACTGCAGCATTAGGTGGTACT GTGGCAAGTTTGATTCAAGTTGCCGCTACTTTGTGCGAGTGGTCATTCGTTCCTAGAAAA TGGGCGGGTGCTCAACATTTGTCCCGTAGATTCTGGTTCTTGTGTGTCATTATGGGTATT AATTTGGGGCCTGTGATATTTGTTTTCGCTTATGATAAGGACACAGTATATTCTACTGCC GCTCATGTCGTTGGAGCAGTTATGTTTTTTGTTGCTGTGGCAACACTTGTTTTCTTTTCC GTAATGCCATTGGGTGGATTATTTACATCGTATATGAAAAAGTCCACAAGAAGTTATGTT GCCTCACAGACCTTCACCGCATCTTTTGCTCCATTGCATGGTTTAGACAGGTGGATGTCT TATTTGGTTTGGGTAACCGTTTTTGCTGCTAAATATGCAGAGTCATATTTTTTTCTAATA CTGTCACTAAGAGATCCAATTAGGATTTTATCTACTACATCAATGAGATGTACTGGTGAA TACTGGTGGGGTAATAAGATTTGTAAGGTCCAGCCAAAGATTGTTTTAGGTTTAATGATT GCGACTGACTTCATTTTGTTCTTTTTGGATACCTACTTGTGGTATATCGTTGTTAACACT GTTTTCTCGGTCGGAAAATCGTTCTATTTGGGTATTTCTATCTTAACTCCATGGAGAAAT ATTTTCACTAGATTGCCAAAAAGAATTTATTCTAAGATCTTGGCTACTACTGATATGGAA ATAAAATATAAACCGAAAGTACTAATTTCTCAGATTTGGAATGCTATCATTATCTCCATG TACAGAGAACATTTATTAGCCATAGACCATGTACAAAAATTGTTATATCATCAGGTTCCG TCCGAAATTGAAGGTAAGAGGACTTTGAGAGCACCAACTTTCTTTGTTTCCCAAGATGAC AATAATTTTGAGACTGAATTTTTCCCTAGAGATTCAGAAGCTGAGCGCCGTATTTCATTT TTTGCCCAATCTCTATCCACTCCAATTCCAGAACCACTACCAGTTGACAACATGCCAACA TTTACTGTATTAACTCCCCATTACGCCGAGAGGATTCTATTATCATTGAGAGAAATTATT CGTGAAGATGATCAATTTTCAAGAGTTACTCTTTTGGAATACCTGAAGCAATTACACCCG GTAGAATGGGACTGTTTTGTTAAGGATACGAAAATTCTTGCTGAAGAAACGGCCGCATAT GAAAACAATGAAGATGAACCTGAAAAGGAAGACGCTCTGAAATCTCAAATTGATGATTTA CCTTTCTATTGTATTGGTTTCAAATCTGCTGCACCAGAATACACCTTACGTACGAGAATC TGGGCCTCTTTAAGGTCGCAAACTTTGTATCGCACAATCTCGGGGTTTATGAATTATTCG AGGGCCATAAAATTACTTTATCGTGTGGAAAATCCAGAAATCGTTCAAATGTTCGGTGGT AATGCTGATGGATTAGAAAGAGAACTGGAAAAAATGGCAAGGCGAAAATTCAAATTCTTG GTTTCGATGCAAAGATTGGCCAAGTTTAAACCACATGAACTAGAAAATGCTGAGTTCCTG TTGAGAGCTTATCCGGACTTGCAAATTGCCTACCTGGATGAAGAACCTCCCTTAAACGAA GGCGAAGAGCCAAGAATTTACTCGGCCTTAATTGATGGTCATTGTGAGATTTTAGAGAAT GGTCGTAGACGTCCCAAATTTAGAGTTCAACTATCCGGTAATCCAATTCTTGGTGATGGT AAATCAGATAATCAAAATCATGCTTTGATTTTTTACAGAGGTGAGTATATTCAATTGATT GATGCTAATCAAGACAATTACTTGGAAGAGTGTTTGAAAATCAGGTCTGTCTTAGCAGAA TTTGAAGAATTGGGAATTGAGCAAATTCATCCTTATACTCCTGGTTTAAAATATGAGGAC CAATCCACAAATCATCCTGTTGCAATTGTCGGCGCTAGAGAATATATTTTCTCAGAAAAC TCTGGTGTTCTTGGTGATGTAGCGGCTGGTAAAGAACAAACTTTTGGTACATTATTTGCC CGTACTTTGGCACAGATTGGTGGTAAATTGCATTATGGTCATCCAGATTTTATTAATGCG ACATTCATGACTACTAGGGGTGGTGTTTCCAAAGCACAAAAGGGTCTACATTTAAATGAA GATATTTATGCCGGTATGAATGCCGTACTTCGGGGTGGTCGTATCAAGCATTGCGAATAT TATCAGTGTGGTAAAGGTAGAGATTTAGGTTTTGGTACAATTTTGAATTTCACTACTAAG ATCGGTGCTGGTATGGGTGAACAAATGTTATCTCGTGAATACTATTATTTGGGTACGCAA TTACCTATTGACCGTTTTTTAACATTTTATTATGCGCATCCAGGGTTTCACTTGAATAAC TTATTTATTCAATTGTCTCTGCAGATGTTCATGTTAACTTTAGTGAACTTGCATGCTTTG GCTCATGAATCCATTCTGTGTGTTTACGATAGGGATAAGCCAATTACTGATGTTTTGTAT CCAATTGGTTGTTACAACTTTCATCCTGCGATTGATTGGGTGAGACGTTATACACTCTCT ATTTTCATCGTCTTTTGGATTGCTTTTGTCCCTATTGTCGTTCAGGAATTAATCGAGCGT GGTCTGTGGAAGGCGACACAAAGATTTTTCCGTCACATTTTATCTCTATCTCCAATGTTT GAAGTCTTTGCTGGCCAAATCTATTCTTCAGCACTGTTAAGTGATATCGCTGTGGGTGGT GCTCGTTATATTTCAACAGGTCGTGGCTTTGCTACATCTCGTATACCTTTCTCTATTCTT TATTCAAGATTTGCGGGTTCAGCCATTTATATGGGATCAAGATCAATGTTGATGTTATTA TTTGGTACCGTGGCACATTGGCAAGCTCCACTATTATGGTTTTGGGCATCATTATCAGCC TTAATCTTTGCACCATTCATTTTCAATCCACATCAATTTGCTTGGGAAGATTTTTTCCTA GACTACAGAGATTATATCAGATGGCTGTCAAGAGGTAATAATAAGTACCACAGGAACTCA TGGATTGGTTATGTAAGAATGTCGAGGTCTCGTGTTACTGGTTTCAAGCGCAAACTGGTG GGTGATGAGTCTGAAAAATCTGCAGGCGATGCAAGCAGGGCTCATAGAACCAATTTAATT ATGGCTGAAATTATACCGTGTGCGATTTACGCAGCAGGTTGTTTTATTGCCTTCACGTTT ATTAATGCACAAACTGGTGTCAAGACTACTGATGAAGATAGAGTAAATTCCACCTTACGT ATCATCATTTGCACCTTGGCGCCTATTGTTATCGATATTGGTGTTTTATTCTTCTGTATG GGTTTGTCATGCTGCTCTGGCCCTTTGTTGGGCATGTGCTGCAAGAAAACTGGTTCTGTT ATGGCAGGGATCGCTCACGGTATCGCTGTTGTTGTCCATATTGTCTTTTTCATTGTCATG TGGGTTTTAGAGGGTTTTAGTTTTGTTAGGATGTTGATTGGCGTTGTTACATGTATACAA TGTCAAAGGTTGATTTTTCACTGTATGACTGTACTGTTGCTGACCCGTGAGTTCAAGAAT GATCACGCTAATACTGCCTTTTGGACAGGCAAATGGTACAGCACCGGTTTAGGATATATG GCATGGACTCAACCGACAAGGGAATTGACTGCAAAAGTCATTGAGCTTTCCGAGTTTGCA GCGGATTTTGTTTTGGGGCATGTAATTTTGATCTTCCAACTACCAGTCATTTGTATTCCA AAGATAGATAAGTTTCACTCCATCATGTTATTTTGGTTAAAACCATCCCGTCAAATCCGT CCTCCTATTTACTCTTTGAAACAAGCACGCCTACGTAAACGTATGGTTAGGAGGTATTGC AGCTTGTACTTTTTGGTACTGATCATATTCGCGGGATGCATCGTTGGCCCTGCCGTTGCT TCAGCACATGTTCCAAAAGACCTTGGATCTGGGTTGACGGGTACTTTCCATAACTTGGTT CAACCAAGGAACGTATCTAACAATGATACAGGGTCCCAGATGTCTACTTATAAGAGTCAT TATTACACTCATACGCCATCCTTAAAGACCTGGTCTACGATCAAATGA
Protein Properties
Pfam Domain Function
Protein Residues1895
Protein Molecular Weight216988.0
Protein Theoretical pI7.02
Signalling Regions
  • None
Transmembrane Regions
  • 474-494
  • 512-532
  • 551-571
  • 583-603
  • 1580-1600
  • 1621-1641
  • 1759-1779
  • 1822-1842
Protein Sequence>1,3-beta-glucan synthase component GSC2 MSYNDPNLNGQYYSNGDGTGDGNYPTYQVTQDQSAYDEYGQPIYTQNQLDDGYYDPNEQY VDGTQFPQGQDPSQDQGPYNNDASYYNQPPNMMNPSSQDGENFSDFSSYGPPSGTYPNDQ YTPSQMSYPDQDGSSGASTPYGNGVVNGNGQYYDPNAIEMALPNDPYPAWTADPQSPLPI EQIEDIFIDLTNKFGFQRDSMRNMFDHFMTLLDSRSSRMSPEQALLSLHADYIGGDTANY KKWYFAAQLDMDDEIGFRNMKLGKLSRKARKAKKKNKKAMQEASPEDTEETLNQIEGDNS LEAADFRWKSKMNQLSPFEMVRQIALFLLCWGEANQVRFTPECLCFIYKCASDYLDSAQC QQRPDPLPEGDFLNRVITPLYRFIRSQVYEIVDGRYVKSEKDHNKVIGYDDVNQLFWYPE GIAKIVMEDGTRLIDLPAEERYLKLGEIPWDDVFFKTYKETRSWLHLVTNFNRIWIMHIS VYWMYCAYNAPTFYTHNYQQLVDNQPLAAYKWATAALGGTVASLIQVAATLCEWSFVPRK WAGAQHLSRRFWFLCVIMGINLGPVIFVFAYDKDTVYSTAAHVVGAVMFFVAVATLVFFS VMPLGGLFTSYMKKSTRSYVASQTFTASFAPLHGLDRWMSYLVWVTVFAAKYAESYFFLI LSLRDPIRILSTTSMRCTGEYWWGNKICKVQPKIVLGLMIATDFILFFLDTYLWYIVVNT VFSVGKSFYLGISILTPWRNIFTRLPKRIYSKILATTDMEIKYKPKVLISQIWNAIIISM YREHLLAIDHVQKLLYHQVPSEIEGKRTLRAPTFFVSQDDNNFETEFFPRDSEAERRISF FAQSLSTPIPEPLPVDNMPTFTVLTPHYAERILLSLREIIREDDQFSRVTLLEYLKQLHP VEWDCFVKDTKILAEETAAYENNEDEPEKEDALKSQIDDLPFYCIGFKSAAPEYTLRTRI WASLRSQTLYRTISGFMNYSRAIKLLYRVENPEIVQMFGGNADGLERELEKMARRKFKFL VSMQRLAKFKPHELENAEFLLRAYPDLQIAYLDEEPPLNEGEEPRIYSALIDGHCEILEN GRRRPKFRVQLSGNPILGDGKSDNQNHALIFYRGEYIQLIDANQDNYLEECLKIRSVLAE FEELGIEQIHPYTPGLKYEDQSTNHPVAIVGAREYIFSENSGVLGDVAAGKEQTFGTLFA RTLAQIGGKLHYGHPDFINATFMTTRGGVSKAQKGLHLNEDIYAGMNAVLRGGRIKHCEY YQCGKGRDLGFGTILNFTTKIGAGMGEQMLSREYYYLGTQLPIDRFLTFYYAHPGFHLNN LFIQLSLQMFMLTLVNLHALAHESILCVYDRDKPITDVLYPIGCYNFHPAIDWVRRYTLS IFIVFWIAFVPIVVQELIERGLWKATQRFFRHILSLSPMFEVFAGQIYSSALLSDIAVGG ARYISTGRGFATSRIPFSILYSRFAGSAIYMGSRSMLMLLFGTVAHWQAPLLWFWASLSA LIFAPFIFNPHQFAWEDFFLDYRDYIRWLSRGNNKYHRNSWIGYVRMSRSRVTGFKRKLV GDESEKSAGDASRAHRTNLIMAEIIPCAIYAAGCFIAFTFINAQTGVKTTDEDRVNSTLR IIICTLAPIVIDIGVLFFCMGLSCCSGPLLGMCCKKTGSVMAGIAHGIAVVVHIVFFIVM WVLEGFSFVRMLIGVVTCIQCQRLIFHCMTVLLLTREFKNDHANTAFWTGKWYSTGLGYM AWTQPTRELTAKVIELSEFAADFVLGHVILIFQLPVICIPKIDKFHSIMLFWLKPSRQIR PPIYSLKQARLRKRMVRRYCSLYFLVLIIFAGCIVGPAVASAHVPKDLGSGLTGTFHNLV QPRNVSNNDTGSQMSTYKSHYYTHTPSLKTWSTIK
References
External Links
ResourceLink
Saccharomyces Genome Database GSC2
Uniprot IDP40989
Uniprot NameFKS2_YEAST
GenBank Gene IDD42127
Genebank Protein ID577655
General Reference
  • Inoue, S. B., Takewaki, N., Takasuka, T., Mio, T., Adachi, M., Fujii, Y., Miyamoto, C., Arisawa, M., Furuichi, Y., Watanabe, T. (1995). "Characterization and gene cloning of 1,3-beta-D-glucan synthase from Saccharomyces cerevisiae." Eur J Biochem 231:845-854.7649185
  • Mazur, P., Morin, N., Baginsky, W., el-Sherbeini, M., Clemas, J. A., Nielsen, J. B., Foor, F. (1995). "Differential expression and function of two homologous subunits of yeast 1,3-beta-D-glucan synthase." Mol Cell Biol 15:5671-5681.7565718
  • Deutschbauer, A. M., Davis, R. W. (2005). "Quantitative trait loci mapped to single-nucleotide resolution in yeast." Nat Genet 37:1333-1340.16273108
  • Rieger, M., Bruckner, M., Schafer, M., Muller-Auer, S. (1997). "Sequence analysis of 203 kilobases from Saccharomyces cerevisiae chromosome VII." Yeast 13:1077-1090.9290212
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Mazur, P., Baginsky, W. (1996). "In vitro activity of 1,3-beta-D-glucan synthase requires the GTP-binding protein Rho1." J Biol Chem 271:14604-14609.8662910
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Lesage, G., Sdicu, A. M., Menard, P., Shapiro, J., Hussein, S., Bussey, H. (2004). "Analysis of beta-1,3-glucan assembly in Saccharomyces cerevisiae using a synthetic interaction network and altered sensitivity to caspofungin." Genetics 167:35-49.15166135
  • Huang, L. S., Doherty, H. K., Herskowitz, I. (2005). "The Smk1p MAP kinase negatively regulates Gsc2p, a 1,3-beta-glucan synthase, during spore wall morphogenesis in Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 102:12431-12436.16116083
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Ishihara, S., Hirata, A., Nogami, S., Beauvais, A., Latge, J. P., Ohya, Y. (2007). "Homologous subunits of 1,3-beta-glucan synthase are important for spore wall assembly in Saccharomyces cerevisiae." Eukaryot Cell 6:143-156.17158736
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956