You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOligopeptide transporter 1
Synonyms
  • High affinity glutathione transporter 1
Gene NameOPT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transport
Specific FunctionHigh affinity transporter for glutathione. Also transports tetra- and pentapeptides like the opioids leucine enkephalin (Tyr-Gly-Gly-Phe-Leu) and methionine enkephalin (Tyr- Gly-Gly_Phe-Met) across the cell membrane
Cellular LocationCell membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO Classification
Component
Not Available
Function
Not Available
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 10
LocusYJL212C
Gene Sequence>2400 bp ATGAGTACCATTTATAGGGAGAGCGACTCGTTGGAGTCGGAGCCCTCGCCAACGCCAACA ACCATTCCTATCCAGATCAATATGGAAGAGGAAAAGAAAGATGCTTTCGTTAAGAATATT GACGAGGACGTCAATAATCTCACTGCGACTACTGATGAGGAGGACCGCGATCCGGAAAGC CAAAAATTCGACAGGCATTCCATACAGGAGGAAGGTCTCGTTTGGAAGGGCGACCCTACA TACTTGCCCAATTCTCCATATCCTGAAGTGAGATCGGCGGTGTCCATCGAGGATGACCCC ACCATCCGCCTCAACCACTGGAGAACGTGGTTCTTGACCACGGTGTTTGTGGTAGTTTTC GCCGGTGTTAATCAATTTTTTTCCCTGAGATATCCATCGCTAGAGATCAACTTCCTTGTT GCACAAGTTGTTTGCTACCCAATTGGTAGGATACTGGCTCTCTTGCCCGACTGGAAGTGT TCTAAAGTGCCATTTTTCGATTTAAACCCGGGCCCATTTACCAAAAAGGAACACGCCGTG GTCACAATTGCCGTGGCGCTTACTTCCTCTACTGCATACGCTATGTACATTTTGAACGCC CAGGGAAGCTTTTACAACATGAAACTTAATGTCGGATATCAGTTCTTGTTGGTTTGGACA TCTCAAATGATTGGTTATGGTGCTGCAGGTCTTACCAGAAGATGGGTCGTCAACCCTGCA AGCTCTATCTGGCCTCAGACTTTAATTTCAGTGTCCTTGTTTGATTCGTTGCACTCGAGA AAAGTTGAAAAGACAGTCGCAAATGGTTGGACGATGCCCCGTTACAGGTTCTTCTTAATC GTCCTTATCGGATCGTTCATCTGGTATTGGGTACCTGGATTCCTCTTTACCGGTCTGTCC TATTTCAACGTTATCCTATGGGGGTCGAAGACAAGACACAATTTCATCGCTAACACAATC TTTGGTACTCAAAGTGGTCTCGGTGCGTTGCCAATTACATTTGACTACACCCAGGTTTCC CAAGCCATGTCCGGCTCTGTTTTCGCCACACCATTCTACGTCTCCGCCAACACCTATGCA TCAGTGTTGATATTCTTCGTCATAGTGCTGCCATGTCTTTATTTTACGAATACCTGGTAT GCCAAATACATGCCCGTCATTTCAGGTTCTACTTATGACAACACTCAAAACAAATACAAC GTAACAAAGATTCTTAACGAGGATTATTCCATTAATCTTGAGAAATATAAGGAATACTCA CCGGTATTCGTTCCATTTTCCTATCTTTTGTCGTATGCTTTAAATTTTGCCGCTGTTATC GCCGTTTTTGTCCACTGCATCTTATACCACGGTAAAGATATTGTCGCCAAGTTTAAAGAC CGTAAAAATGGTGGCACTGACATTCACATGAGAATCTACTCCAAGAACTATAAGGATTGT CCCGATTGGTGGTATTTACTTTTGCAGATTGTCATGATCGGTTTAGGATTTGTAGCAGTG TGCTGTTTCGATACTAAGTTCCCAGCTTGGGCATTTGTTATTGCAATATTAATTTCCCTT GTAAATTTCATCCCGCAAGGTATCTTGGAAGCAATGACTAACCAACACGTAGGTTTGAAT ATTATCACAGAATTGATCTGCGGTTATATGCTGCCTTTAAGACCAATGGCAAACTTATTA TTCAAGCTATACGGATTTATTGTCATGAGACAAGGCTTGAATTTGAGTAGAGATTTGAAA TTAGCCATGTACATGAAGGTTTCCCCTCGTTTGATCTTTGCCGTTCAAATCTATGCCACT ATCATATCAGGCATGGTTAACGTTGGTGTCCAGGAATGGATGATGCATAATATCGATGGC TTATGTACCACCGATCAACCAAATGGCTTCACTTGTGCTAATGGTCGCACGGTTTTCAAT GCTTCCATTATCTGGTCTTTGCCAAAGTATCTTTTCTCATCAGGGCGCATTTATAATCCG CTGATGTGGTTCTTCTTGATTGGTTTGCTATTCCCACTAGCCGTTTATGCTGTTCAATGG AAATTCCCTAAATTTAAATTTGCTAAGCACATTCATACTCCTGTATTTTTCACAGGCCCA GGTAATATTCCACCAAGCACACCTTATAACTACTCATTATTTTTTGCAATGTCATTCTGC CTAAACTTGATAAGAAAAAGATGGAGAGCTTGGTTCAATAAGTACAATTTCGTCATGGGG GCCGGTGTTGAAGCAGGTGTGGCAATCTCCGTCGTCATCATCTTCTTGTGTGTACAGTAC CCAGGTGGTAAGCTCAGCTGGTGGGGAAACAACGTTTGGAAAAGAACGTATGATAATGAT TATAAAAAATTTTATACCTTAAAGAAAGGTGAGACATTTGGTTATGATAAATGGTGGTAA
Protein Properties
Pfam Domain Function
Protein Residues799
Protein Molecular Weight91614.79688
Protein Theoretical pI9.02
Signalling Regions
  • None
Transmembrane Regions
  • 109-129
  • 136-156
  • 178-198
  • 211-231
  • 277-297
  • 314-334
  • 360-380
  • 429-449
  • 483-503
  • 509-529
  • 541-561
  • 591-611
  • 660-680
  • 737-757
Protein Sequence>Oligopeptide transporter 1 MSTIYRESDSLESEPSPTPTTIPIQINMEEEKKDAFVKNIDEDVNNLTATTDEEDRDPES QKFDRHSIQEEGLVWKGDPTYLPNSPYPEVRSAVSIEDDPTIRLNHWRTWFLTTVFVVVF AGVNQFFSLRYPSLEINFLVAQVVCYPIGRILALLPDWKCSKVPFFDLNPGPFTKKEHAV VTIAVALTSSTAYAMYILNAQGSFYNMKLNVGYQFLLVWTSQMIGYGAAGLTRRWVVNPA SSIWPQTLISVSLFDSLHSRKVEKTVANGWTMPRYRFFLIVLIGSFIWYWVPGFLFTGLS YFNVILWGSKTRHNFIANTIFGTQSGLGALPITFDYTQVSQAMSGSVFATPFYVSANTYA SVLIFFVIVLPCLYFTNTWYAKYMPVISGSTYDNTQNKYNVTKILNEDYSINLEKYKEYS PVFVPFSYLLSYALNFAAVIAVFVHCILYHGKDIVAKFKDRKNGGTDIHMRIYSKNYKDC PDWWYLLLQIVMIGLGFVAVCCFDTKFPAWAFVIAILISLVNFIPQGILEAMTNQHVGLN IITELICGYMLPLRPMANLLFKLYGFIVMRQGLNLSRDLKLAMYMKVSPRLIFAVQIYAT IISGMVNVGVQEWMMHNIDGLCTTDQPNGFTCANGRTVFNASIIWSLPKYLFSSGRIYNP LMWFFLIGLLFPLAVYAVQWKFPKFKFAKHIHTPVFFTGPGNIPPSTPYNYSLFFAMSFC LNLIRKRWRAWFNKYNFVMGAGVEAGVAISVVIIFLCVQYPGGKLSWWGNNVWKRTYDND YKKFYTLKKGETFGYDKWW
References
External Links
ResourceLink
Saccharomyces Genome Database OPT1
Uniprot IDP40897
Uniprot NameOPT1_YEAST
GenBank Gene IDZ34098
Genebank Protein ID496950
General Reference
  • Vandenbol, M., Durand, P., Bolle, P. A., Dion, C., Portetelle, D., Hilger, F. (1994). "Sequence analysis of a 40.2 kb DNA fragment located near the left telomere of yeast chromosome X." Yeast 10:1657-1662.7725802
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Hauser, M., Donhardt, A. M., Barnes, D., Naider, F., Becker, J. M. (2000). "Enkephalins are transported by a novel eukaryotic peptide uptake system." J Biol Chem 275:3037-3041.10652283
  • Bourbouloux, A., Shahi, P., Chakladar, A., Delrot, S., Bachhawat, A. K. (2000). "Hgt1p, a high affinity glutathione transporter from the yeast Saccharomyces cerevisiae." J Biol Chem 275:13259-13265.10788431
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956