You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexose transporter HXT9
SynonymsNot Available
Gene NameHXT9
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00072D-GalactoseShow
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
transmembrane transporter activity
substrate-specific transmembrane transporter activity
transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 10
LocusYJL219W
Gene Sequence>1704 bp ATGTCCGGTGTTAATAATACATCCGCAAATGATTTATCCACTACCGAGTCTAACTCTAAC TCAGTAGCAAATGCACCATCTGTAAAAACTGAGCATAATGACTCTAAAAACTCCCTCAAC CTGGATGCCACTGAACCACCTATTGACTTACCTCAAAAACCCCTCTCTGCATATACCACC GTCGCAATCCTGTGTTTGATGATTGCATTTGGCGGCTTCATCTTTGGTTGGGATACCGGT ACCATTTCTGGTTTTGTTAACCTTTCTGATTTCATCAGAAGGTTCGGTCAAAAAAATGAC AAGGGAACCTACTACTTATCGAAAGTAAGAATGGGTTTGATCGTCTCAATATTCAACATT GGCTGCGCCATAGGCGGAATTGTCTTGTCAAAAGTCGGTGATATATATGGTCGTCGTATT GGATTGATTACAGTTACTGCCATTTACGTTGTAGGCATCCTAATCCAAATAACTTCCATA AACAAGTGGTACCAATACTTCATTGGAAGAATTATTTCTGGCCTAGGAGTGGGAGGCATT GCTGTCCTTTCCCCAATGTTGATATCTGAAGTTGCTCCCAAACAAATCAGAGGAACCCTG GTCCAATTGTACCAGCTGATGTGTACGATGGGTATTTTTCTAGGATACTGTACCAATTAC GGTACCAAGAACTATCACAACGCCACTCAATGGAGAGTCGGCCTTGGTCTTTGCTTTGCC TGGACTACATTCATGGTTAGTGGAATGATGTTTGTACCAGAATCACCACGTTACCTGATT GAGGTTGGTAAAGATGAGGAAGCGAAACGTTCACTTTCGAAATCCAACAAAGTCTCAGTC GACGATCCAGCCTTGTTAGCAGAATATGACACTATAAAGGCGGGAATCGAACTTGAAAAG CTGGCAGGTAACGCATCATGGTCTGAACTACTCTCCACTAAAACAAAGGTCTTTCAGCGT GTTCTCATGGGAGTGATGATCCAATCGCTGCAGCAATTAACCGGTGATAACTACTTCTTT TACTACGGCACCACCATCTTCAAATCTGTCGGTCTAAAGGACTCCTTTCAGACTTCGATC ATTATCGGTGTGGTTAATTTTTTCTCTTCATTCATAGCGGTATACACCATTGAGAGGTTT GGACGCCGTACGTGTCTATTGTGGGGTGCTGCTTCTATGCTATGCTGCTTTGCTGTGTTT GCCTCCGTCGGTGTGACAAAGTTGTGGCCTCAAGGAAGCAGTCACCAAGACATTACTTCT CAGGGCGCCGGTAACTGTATGATTGTGTTTACTATGTTCTTCATTTTTTCGTTCGCCACC ACTTGGGCAGGCGGCTGTTACGTTATTGTCTCAGAGACGTTTCCTCTTAGGGTCAAATCA AGAGGAATGGCAATCGCAACAGCTGCAAACTGGATGTGGGGTTTCCTGATTAGTTTCTTT ACCCCATTCATTACCGGGGCAATCAACTTTTACTACGGTTATGTATTCTTAGGCTGTCTG GTTTTTGCATACTTTTATGTCTTTTTCTTTGTCCCAGAAACAAAAGGCCTGACGCTGGAG GAGGTGAATACTATGTGGCTGGAAGGTGTGCCAGCATGGAAATCAGCCTCATGGGTGCCA CCAGAAAGAAGAACCGCAGATTACGATGCTGACGCCATAGACCATGACGATAGACCAATC TACAAGAGGTTCTTTTCCAGCTAA
Protein Properties
Pfam Domain Function
Protein Residues567
Protein Molecular Weight62857.19922
Protein Theoretical pI8.3
Signalling Regions
  • None
Transmembrane Regions
  • 57-77
  • 113-133
  • 140-160
  • 171-191
  • 198-218
  • 233-253
  • 337-353
  • 360-377
  • 385-405
  • 430-450
  • 468-488
  • 490-510
Protein Sequence>Hexose transporter HXT9 MSGVNNTSANDLSTTESNSNSVANAPSVKTEHNDSKNSLNLDATEPPIDLPQKPLSAYTT VAILCLMIAFGGFIFGWDTGTISGFVNLSDFIRRFGQKNDKGTYYLSKVRMGLIVSIFNI GCAIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGI AVLSPMLISEVAPKQIRGTLVQLYQLMCTMGIFLGYCTNYGTKNYHNATQWRVGLGLCFA WTTFMVSGMMFVPESPRYLIEVGKDEEAKRSLSKSNKVSVDDPALLAEYDTIKAGIELEK LAGNASWSELLSTKTKVFQRVLMGVMIQSLQQLTGDNYFFYYGTTIFKSVGLKDSFQTSI IIGVVNFFSSFIAVYTIERFGRRTCLLWGAASMLCCFAVFASVGVTKLWPQGSSHQDITS QGAGNCMIVFTMFFIFSFATTWAGGCYVIVSETFPLRVKSRGMAIATAANWMWGFLISFF TPFITGAINFYYGYVFLGCLVFAYFYVFFFVPETKGLTLEEVNTMWLEGVPAWKSASWVP PERRTADYDADAIDHDDRPIYKRFFSS
References
External Links
ResourceLink
Saccharomyces Genome Database HXT9
Uniprot IDP40885
Uniprot NameHXT9_YEAST
GenBank Gene IDZ34098
Genebank Protein ID496942
General Reference
  • Vandenbol, M., Durand, P., Bolle, P. A., Dion, C., Portetelle, D., Hilger, F. (1994). "Sequence analysis of a 40.2 kb DNA fragment located near the left telomere of yeast chromosome X." Yeast 10:1657-1662.7725802
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258