You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlutathione S-transferase 1
Synonyms
  • GST-I
Gene NameGTT1
Enzyme Class
Biological Properties
General FunctionInvolved in protein binding
Specific FunctionRX + glutathione = HX + R-S-glutathione
Cellular LocationEndoplasmic reticulum membrane; Peripheral membrane protein
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO ClassificationNot Available
Gene Properties
Chromosome Locationchromosome 9
LocusYIR038C
Gene Sequence>705 bp ATGTCGTTGCCAATTATCAAAGTCCATTGGTTGGACCATTCCAGAGCGTTCAGACTTTTG TGGTTATTAGACCATTTGAACCTTGAATATGAAATTGTCCCTTATAAAAGAGATGCTAAC TTCCGTGCTCCACCAGAATTAAAGAAAATTCACCCATTAGGAAGATCTCCATTGTTAGAA GTTCAAGACAGAGAAACTGGTAAGAAGAAGATACTTGCCGAGTCCGGTTTCATCTTCCAA TATGTCTTGCAGCATTTTGATCATTCACACGTTTTAATGAGCGAAGATGCTGATATTGCA GACCAGATTAACTATTATCTGTTTTATGTAGAAGGTTCCTTGCAACCACCTTTAATGATT GAGTTCATTCTTTCAAAGGTGAAGGATTCTGGTATGCCCTTCCCTATTTCGTACTTGGCA AGAAAAGTGGCAGACAAGATCAGTCAGGCATACTCTAGTGGTGAAGTTAAGAACCAGTTC GACTTTGTGGAGGGTGAAATTTCCAAAAATAACGGCTACCTGGTTGATGGGAAGTTGAGC GGTGCCGATATCTTGATGTCTTTCCCTTTGCAGATGGCGTTTGAAAGAAAGTTTGCCGCA CCAGAGGATTATCCTGCCATTTCCAAATGGTTAAAGACCATAACCTCAGAGGAGTCGTAT GCTGCTTCTAAGGAAAAGGCGCGTGCTTTAGGTAGCAATTTCTAA
Protein Properties
Pfam Domain Function
Protein Residues234
Protein Molecular Weight26794.5
Protein Theoretical pI6.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glutathione S-transferase 1 MSLPIIKVHWLDHSRAFRLLWLLDHLNLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLE VQDRETGKKKILAESGFIFQYVLQHFDHSHVLMSEDADIADQINYYLFYVEGSLQPPLMI EFILSKVKDSGMPFPISYLARKVADKISQAYSSGEVKNQFDFVEGEISKNNGYLVDGKLS GADILMSFPLQMAFERKFAAPEDYPAISKWLKTITSEESYAASKEKARALGSNF
References
External Links
ResourceLink
Saccharomyces Genome Database GTT1
Uniprot IDP40582
Uniprot NameGST1_YEAST
GenBank Gene IDZ38061
Genebank Protein ID557844
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Choi, J. H., Lou, W., Vancura, A. (1998). "A novel membrane-bound glutathione S-transferase functions in the stationary phase of the yeast Saccharomyces cerevisiae." J Biol Chem 273:29915-29922.9792709
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956