You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol-1,4,5-trisphosphate 5-phosphatase 1
Synonyms
  • Synaptojanin-like protein 1
Gene NameINP51
Enzyme Class
Biological Properties
General FunctionInvolved in inositol or phosphatidylinositol phosphatase activity
Specific FunctionControls the cellular levels and subcellular distribution of phosphatidylinositol 3-phosphate and phosphatidylinositol 4,5-bisphosphate. Plays an essential role in a TGN (trans Golgi network)-to-early endosome pathway. Involved in endocytosis and acts as a negative regulator of the Slm pathway which modulates polarized actin assembly and growth
Cellular LocationCytoplasm, cytoskeleton, actin patch
SMPDB Pathways
Inositol MetabolismPW002498 ThumbThumb?image type=greyscaleThumb?image type=simple
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
1D-Myo-Inositol 1,3,4,5-tetrakisphosphate + waterInositol 1,3,4-trisphosphate + phosphate
Inositol 1,4,5-trisphosphate + water1D-myo-inositol 1,4-bisphosphate + phosphate
1D-Myo-Inositol 1,3,4,5-tetrakisphosphate + water1D-myo-inositol 1,4-bisphosphate + phosphate
KEGG Reactions
water + 1D-myo-inositol 4,5-bisphosphatephosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate + hydron
water + 1D-myo-inositol 4,5-bisphosphatephosphate + 1-phosphatidyl-1D-myo-inositol 4-phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00291Inositol 1,4,5-trisphosphateShow
YMDB007111D-Myo-Inositol 1,3,4,5-tetrakisphosphateShow
YMDB008521D-myo-inositol 1,4-bisphosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB16131Inositol 1,3,4-trisphosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
inositol or phosphatidylinositol phosphatase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 9
LocusYIL002C
Gene Sequence>2841 bp ATGAGACTCTTCATCGGTAGAAGATCACGGTCGATTGTAATATCTTCCAACAACTACTGT TTATCCTTCCAGCGTTTGCGCAGCATACCAGGTGCCAGTTCTCAGCAGCGTCAATTAAGT AAAACTCCTAGCGTAACAATCAAGTCCTACCCTGACACAGATCTTTCAAGTGATAGTAAC TATCTCGAAGTCAAAAGTTGCATATTTAATGGATTATTAGGGCTCGTTTGTCTTAATGGT GATATATATGTTGCCGTCATATCTGGTGTTCAGAATGTTGGGTTTCCTCGATGGAAACTG ATAGATCATCAAGTTAGGCCTTCGGAGAGCATTTATAAAGTATTGGATGTTGACTTTTAC AGCTTAGAAAATGATGTTTTCGACTACCTCCTCTGCGAGAGATCAGAGCAAAACTATGAT AAATTGATTCATGAGCATCCTTGCGGCCCCCTGAAAAAACTGTTTAGTGATGGAACATTC TACTATTCTAGAGATTTCGACATCTCTAATATCGTGAAAAACCATGGTTTATCACATAAC TTAGAATATACCGTAGATAATCAAGATTTATCATTTATTTGGAATGCTAACTTAGCAAGT GAGGTAATCAACTGGAGAAGCAAGATTTCAAATGAGGAGAAACAACTTTTTGCCAACGCA GGGTTCTTAACATTTGTAATTCGGGGTTATTGCAAGACAGCATTAATAGAAGACGGCCCA AATACAGCCTCTATAACCATTATTTCCAGAATTTCGACTGAGAGCAAGCAGGATACGCTA GAATTGGAGGGTATTAGTGAAGATGGGAGAGTGTCGCTATTTGTTGAGACAGAAATTGTA GTAACCACAGAAAAGTTTATTTTTTCTTATACTCAAGTGAACGGAAGCATTCCTCTTTTT TGGGAATCTGTAGAAAGTCAACTGTTGTATGGAAAAAAAATTAAGGTAACAAAAGATTCT ATTGAAGCTCAGGGAGCTTTTGACAGGCATTTTGATAATTTAACCTCAAAGTATGGTGTT GTGAGTATCGTTAATATCATAAAACCTAAAAGCGAATCACAAGAAAAGTTAGCACTGACG TACAAGGATTGTGCTGAATCAAAGGGAATAAAAATAACAAATATAGAATACAGCTCAAGC GTTCTGACAAAGTCTCCCCACAAATTACTTTATTTATTAAAACAGGATATTTACGAGTTT GGAGCGTTTGCCTATGATATCTCTAGGGGCATCTACTTTGCAAAACAAACGGGGGTATTA AGAATAAGCGCATTTGATTCAATTGAAAAACCTAACACAGTTGAAAGGTTAGTGAGCAAG GAGGTACTTGAATTAACCACAAATGAAATTGATGTATTTGAATTGACTTCCCCATTCTTG GACGCACATGATAAGCTATGGTCAGAAAACTATTACTGGCTTGATCGAACGTATACTAAG CACACGAAGAATTCTGGTAAATATACAAAGGTTTATTCGAAGTTATTTGGTTCCCGAGTT AGATTATACGACCCGCTCCATATCTACATCTCTCAGTATTTAAAGCAATTAAGGTCAAAA TATACGTTTGAGAAAGACATCTCAATTTTTGCAGGTACATTTAATATAAGTGGTAAAATT CCAAAAGATGATATAAAAGATTGGATATTTCCAAAATCAATGTCCAAGGAGGATGAAATG GCTGATCTTTATGTTATCGGATTAGAAGAAGTGGTAGAACTTACCCCAGGTCATATGCTT GCTACCGATCCATATGTCCGACAATTTTGGGAGAAGAAGATATTAACACTATTAAATGGG CCCGGACGCAAAAAAAAATATATCCGTTTATGGAGTACACAGTTGGGTGGTATTTTACTA TTATTATTCATGAATGAAACGGAATATTCCAAGGTAAAGCATATTGAGGGGGATGTTAAA AAAACCGGGTTTGGAGGAATGGCTTCTAATAAAGGAGCTGTCGCGGTTAGTTTTAAATAC TCAGCTACAAGATTTTGCGTACTAGTATCTCATTTAGCGGCAGGCTTAGAAAATGTTGAA CAAAGGCATAATGATTATAAGACGATTGCGAAAAGCATACGATTTTCTAAAGGATTACGA ATAAAGGATCACGATGCAATTATTTGGATGGGCGATTTCAATTACAGAATATTGATGTCA AACGAAGATGTTAGACGAAAAATTGTTTCTAAAGAATATGCCAGCCTATTTGAAAAGGAT CAACTTAATCAACAAATGATCGCAGGTGAGTCTTTTCCATATTTCCATGAAATGGCGATT GATTTCCCACCTACCTATAAATTCGACCCAGGAACTAAAAACTACGACACGAGCGAAAAA ATGAGAATACCAGCATGGACTGATAGGATTTTAAGTAGGGGAGAAGTACTAGAACAGTTA GAATATAAATGCTGTGAAGATATACTATTTTCCGATCATCGGCCCGTATATGCCATATTT AGGGCTAGAGTGACTGTAGTGGATGAACAAAAAAAGACTACTTTGGGTACGCAAATCTAC GAGAAGATTATGGAAAGGCTAGAGGGATTGGATGATGATGAGAAAATTGCAGTTTTGAGT GATGATGCATTTGTTATCGAAAGTTTTGAGGGCAGTGATTCGATAGCTGGCCCTACGCAT TCTCCGACACCAATTCCCGAGCCCAAAAGAGGTAGAAAGTTACCACCACCTAGTTCGGAT TTAAAAAAATGGTGGATTGGAAGTGGGAAGCAAGTTAAAGTAGTTCTTGACGTAGACCCG GCCGTTTACATGATTAATCCTAAAAGAGATCCCAATCCATTCGTTGAGAACGAAGATGAG CCACTTTTTATAGAAAGGTAA
Protein Properties
Pfam Domain Function
Protein Residues946
Protein Molecular Weight108429.0
Protein Theoretical pI6.7
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol-1,4,5-trisphosphate 5-phosphatase 1 MRLFIGRRSRSIVISSNNYCLSFQRLRSIPGASSQQRQLSKTPSVTIKSYPDTDLSSDSN YLEVKSCIFNGLLGLVCLNGDIYVAVISGVQNVGFPRWKLIDHQVRPSESIYKVLDVDFY SLENDVFDYLLCERSEQNYDKLIHEHPCGPLKKLFSDGTFYYSRDFDISNIVKNHGLSHN LEYTVDNQDLSFIWNANLASEVINWRSKISNEEKQLFANAGFLTFVIRGYCKTALIEDGP NTASITIISRISTESKQDTLELEGISEDGRVSLFVETEIVVTTEKFIFSYTQVNGSIPLF WESVESQLLYGKKIKVTKDSIEAQGAFDRHFDNLTSKYGVVSIVNIIKPKSESQEKLALT YKDCAESKGIKITNIEYSSSVLTKSPHKLLYLLKQDIYEFGAFAYDISRGIYFAKQTGVL RISAFDSIEKPNTVERLVSKEVLELTTNEIDVFELTSPFLDAHDKLWSENYYWLDRTYTK HTKNSGKYTKVYSKLFGSRVRLYDPLHIYISQYLKQLRSKYTFEKDISIFAGTFNISGKI PKDDIKDWIFPKSMSKEDEMADLYVIGLEEVVELTPGHMLATDPYVRQFWEKKILTLLNG PGRKKKYIRLWSTQLGGILLLLFMNETEYSKVKHIEGDVKKTGFGGMASNKGAVAVSFKY SATRFCVLVSHLAAGLENVEQRHNDYKTIAKSIRFSKGLRIKDHDAIIWMGDFNYRILMS NEDVRRKIVSKEYASLFEKDQLNQQMIAGESFPYFHEMAIDFPPTYKFDPGTKNYDTSEK MRIPAWTDRILSRGEVLEQLEYKCCEDILFSDHRPVYAIFRARVTVVDEQKKTTLGTQIY EKIMERLEGLDDDEKIAVLSDDAFVIESFEGSDSIAGPTHSPTPIPEPKRGRKLPPPSSD LKKWWIGSGKQVKVVLDVDPAVYMINPKRDPNPFVENEDEPLFIER
References
External Links
ResourceLink
Saccharomyces Genome Database INP51
Uniprot IDP40559
Uniprot NameINP51_YEAST
GenBank Gene IDZ38062
Genebank Protein ID557848
General Reference
  • Voss, H., Tamames, J., Teodoru, C., Valencia, A., Sensen, C., Wiemann, S., Schwager, C., Zimmermann, J., Sander, C., Ansorge, W. (1995). "Nucleotide sequence and analysis of the centromeric region of yeast chromosome IX." Yeast 11:61-78.7762303
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Luo, W., Chang, A. (1997). "Novel genes involved in endosomal traffic in yeast revealed by suppression of a targeting-defective plasma membrane ATPase mutant." J Cell Biol 138:731-746.9265642
  • Stolz, L. E., Huynh, C. V., Thorner, J., York, J. D. (1998). "Identification and characterization of an essential family of inositol polyphosphate 5-phosphatases (INP51, INP52 and INP53 gene products) in the yeast Saccharomyces cerevisiae." Genetics 148:1715-1729.9560389
  • Singer-Kruger, B., Nemoto, Y., Daniell, L., Ferro-Novick, S., De Camilli, P. (1998). "Synaptojanin family members are implicated in endocytic membrane traffic in yeast." J Cell Sci 111 ( Pt 22):3347-3356.9788876
  • O'Malley, C. J., McColl, B. K., Kong, A. M., Ellis, S. L., Wijayaratnam, A. P., Sambrook, J., Mitchell, C. A. (2001). "Mammalian inositol polyphosphate 5-phosphatase II can compensate for the absence of all three yeast Sac1-like-domain-containing 5-phosphatases." Biochem J 355:805-817.11311145
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Morales-Johansson, H., Jenoe, P., Cooke, F. T., Hall, M. N. (2004). "Negative regulation of phosphatidylinositol 4,5-bisphosphate levels by the INP51-associated proteins TAX4 and IRS4." J Biol Chem 279:39604-39610.15265867
  • Nguyen, P. H., Hasek, J., Kohlwein, S. D., Romero, C., Choi, J. H., Vancura, A. (2005). "Interaction of Pik1p and Sjl proteins in membrane trafficking." FEMS Yeast Res 5:363-371.15691741
  • Fadri, M., Daquinag, A., Wang, S., Xue, T., Kunz, J. (2005). "The pleckstrin homology domain proteins Slm1 and Slm2 are required for actin cytoskeleton organization in yeast and bind phosphatidylinositol-4,5-bisphosphate and TORC2." Mol Biol Cell 16:1883-1900.15689497
  • Sun, Y., Carroll, S., Kaksonen, M., Toshima, J. Y., Drubin, D. G. (2007). "PtdIns(4,5)P2 turnover is required for multiple stages during clathrin- and actin-dependent endocytic internalization." J Cell Biol 177:355-367.17452534