You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameATP-dependent permease PDR11
SynonymsNot Available
Gene NamePDR11
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionTransporter involved in the uptake of sterol
Cellular LocationMembrane; Multi-pass membrane protein (Potential)
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00262LanosterinShow
YMDB00540episterolShow
YMDB00543ergosterolShow
YMDB0054524-methylidene-5alpha-cholest-8-en-3beta-olShow
YMDB00547lanosterolShow
YMDB00548zymosterolShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
adenyl ribonucleotide binding
primary active transmembrane transporter activity
catalytic activity
ATP binding
P-P-bond-hydrolysis-driven transmembrane transporter activity
nucleotide binding
ATPase activity, coupled to transmembrane movement of substances
transporter activity
pyrophosphatase activity
transmembrane transporter activity
nucleoside-triphosphatase activity
active transmembrane transporter activity
ATPase activity
binding
nucleoside binding
hydrolase activity
purine nucleoside binding
hydrolase activity, acting on acid anhydrides
adenyl nucleotide binding
Process
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 9
LocusYIL013C
Gene Sequence>YIL013C PDR11 SGDID:S000001275, Chr IX from 332442-328207, reverse complement, Verified ORF, "ATP-binding cassette (ABC) transporter, multidrug transporter involved in multiple drug resistance; mediates sterol uptake when sterol biosynthesis is compromise ATGTCTCTTTCCAAATATTTTAATCCAATTCCTGACGCTTCAGTCACCTTTGATGGGGCT ACCGTTCAATTGGAAGAATCCCTCGGTGCTGTTCAGAACGATGAAGAGTCCGCATCGGAA TTCAAAAACGTAGGCCATTTAGAAATTAGTGATATCACTTTTCGTGCTAATGAAGGTGAA GTCGTCTTAGTACTGGGAAACCCAACATCAGCGCTCTTCAAAGGTCTATTCCATGGTCAC AAGCATCTGAAATACTCGCCTGAAGGGTCTATTAGATTCAAAGACAATGAGTACAAACAG TTTGCTTCCAAATGCCCCCATCAGATCATTTATAATAACGAACAAGATATTCACTTCCCG TATCTGACGGTGGAGCAAACCATTGATTTTGCGTTGAGTTGTAAGTTTCACATTCCCAAG CAAGAGCGTATTGAAATGAGAGACGAGTTATTAAAAGAGTTCGGACTGTCGCACGTAAAG AAGACGTATGTGGGTAATGACTACGTTCGTGGTGTTTCTGGAGGTGAAAGGAAACGTATC TCCATTATAGAAACGTTTATTGCCAATGGGTCTGTTTACTTATGGGACAACTCGACGAAG GGTTTGGACTCTGCCACCGCCCTAGAATTTCTTTCCATTACCCAAAAGATGGCAAAAGCT ACAAGATCGGTGAATTTTGTTAAAATTTCTCAAGCAAGCGACAAAATTGTCAGCAAGTTT GACAAGATTCTTATGTTAGGTGATTCCTTCCAGGTGTTTTACGGAACCATGGAGGAGTGT TTAACCCATTTTCATGACACCTTACAGATAAAAAAAAACCCTAACGATTGTATTATTGAA TATTTAACATCAATCTTAAATTTTAAGTTCAAGGAAACGTCTAATTCCATTGTTGGTCTT GACACTCCATCTGTTGTTTCTGAAGAAAATCAAGCTTTAAACATCAATAATGAAACAGAT TTGCATACATTATGGATTCAGTCTCCATACTATAAACACTGGAAGGCCATCACTTCAAAA ACAGTGCAAGAATGCACCAGAAAAGATGTTAATCCGGATGATATCTCCCCCATTTTTAGT ATTCCGCTAAAGACGCAACTGAAAACGTGCACTGTAAGAGCTTTCGAAAGAATCATTGGT GACAGAAACTACTTGATTTCTCAATTTGTTTCTGTTGTGGTGCAGTCTTTGGTTATTGGG TCCCTTTTTTATAACATTCCCCTGACAACAATTGGTTCGTTTTCTAGAGGATCTTTAACT TTCTTTTCCATCCTATTCTTTACATTTCTTTCTCTCGCCGACATGCCTGCTTCCTTTCAA AGGCAACCCGTCGTTCGTAAACATGTCCAGCTCCATTTTTATTATAATTGGGTGGAAACT TTAGCAACAAATTTTTTCGATTGCTGCTCTAAATTTATACTGGTGGTTATTTTTACAATC ATACTTTACTTTTTGGCCCATTTACAGTACAATGCAGCTAGGTTTTTCATCTTTTTGCTT TTCCTTTCCGTCTATAATTTTTGCATGGTGTCACTATTTGCATTAACTGCTTTGATCGCT CCAACTCTATCAATGGCAAACCTATTGGCCGGTATCTTACTGTTAGCCATTGCCATGTAC GCGTCCTATGTTATTTATATGAAAGATATGCATCCATGGTTCATATGGATTGCATATTTG AATCCTGCTATGTTTGCCATGGAAGCCATTTTGAGTAACGAATTGTTTAACCTGAAACTA GACTGTCATGAAAGTATTATTCCCAGAGGTGAATATTATGACAATATTTCATTCAGTCAT AAAGCTTGTGCCTGGCAAGGCGCTACCCTAGGTAACGATTACGTCAGAGGCCGTGATTAT TTAAAAAGTGGATTGAAATACACTTACCATCACGTGTGGAGAAATTTCGGTATTATCATT GGGTTTCTGTGTTTCTTCCTATTTTGCTCTTTACTAGCAGCGGAATATATCACGCCTCTG TTTACTAGAGAAAATTTATTGCGCTGGAATAACTATCTCAAAAGATACTGTCCCTTTCTG AATAGCCAAAAAAAGAATAATAAAAGCGCTATTACCAACAACGATGGCGTATGTACTCCC AAGACCCCGATAGCCAATTTTTCCACTTCATCCTCTTCTGTTCCATCAGTCTCGCATCAA TACGATACTGATTACAATATTAAACATCCAGATGAAACTGTTAACAATCATACTAAGGAA TCCGTAGCTATGGAAACGCAAAAGCACGTCATCTCCTGGAAAAATATCAATTATACCATT GGAGACAAAAAATTGATCAACGACGCTTCTGGATATATAAGTTCCGGATTAACTGCCCTA ATGGGTGAATCTGGTGCTGGTAAGACAACTTTGTTGAATGTCTTGTCTCAAAGGACCGAA AGCGGGGTTGTTACCGGTGAATTATTAATCGATGGACAGCCCTTAACGAATATTGATGCA TTCAGAAGAAGTATAGGGTTCGTTCAACAGCAAGATGTTCATTTAGAGCTCTTAACTGTG AGAGAGTCTTTGGAAATTTCCTGCGTCCTAAGAGGTGATGGGGATAGAGACTATTTAGGA GTTGTTAGCAACCTATTAAGATTGCCTTCGGAAAAACTGGTTGCTGATTTATCTCCAACT CAAAGAAAATTATTATCTATTGGTGTTGAATTGGTCACTAAGCCTTCTCTGTTGTTATTC CTAGATGAACCTACTTCAGGGCTAGACGCCGAAGCAGCTTTAACCATCGTGCAATTTCTG AAAAAGCTTTCGATGCAAGGTCAGGCTATCTTATGTACTATTCATCAGCCTAGCAAAAGT GTCATCAGCTATTTTGATAACATCTATTTACTAAAAAGAGGTGGTGAGTGTGTCTATTTT GGTTCATTACCTAATGCCTGTGACTATTTTGTAGCTCACGATAGACGCCTAACATTTGAC AGAGAAATGGATAATCCGGCTGATTTCGTTATTGACGTTGTTGGTAGCGGAAGTACAAAT ATTCCAATGGATGATGCAGAGAAGCCAACCTCAAGCAAAATTGATGAGCCAGTATCTTAC CATAAGCAATCTGATTCAATTAACTGGGCAGAACTCTGGCAATCCTCTCCAGAAAAAGTG CGGGTTGCTGATGATTTGCTTTTATTAGAAGAAGAAGCCCGGAAATCTGGTGTTGATTTC ACTACGTCCGTATGGAGTCCGCCTTCGTATATGGAACAAATAAAGTTAATCACAAAGAGA CAGTACATTTGTACCAAGAGAGACATGACCTATGTTTTCGCTAAATATGCTTTGAATGCT GGCGCTGGACTATTCATTGGATTTTCATTTTGGAGGACAAAGCATAATATCAACGGTCTG CAAGATGCTATTTTCTTGTGCTTCATGATGCTTTGTGTTTCCTCCCCTTTGATCAATCAG GTTCAAGATAAGGCTTTGCAATCTAAAGAAGTATATATCGCCAGGGAAGCGAGATCTAAT ACTTATCATTGGACCGTTCTTTTGATTGCTCAAACTATTGTTGAATTACCATTAGCCATT TCCAGTTCTACCTTATTTTTCCTGTGTTGCTACTTCTGTTGCGGTTTCGAAACCTCTGCC CGTGTAGCTGGTGTCTTTTACTTGAATTATATTTTATTTTCCATGTATTATTTGTCATTT GGGTTGTGGCTTCTATATTCTGCCCCCGATTTACAAACTGCCGCTGTCTTTGTTGCCTTC CTCTATAGTTTCACAGCTTCATTCTGTGGCGTTATGCAACCATACTCGTTATTCCCAAGA TTTTGGACATTCATGTACAGGGTTTCACCATACACGTATTTCATTGAAACTTTCGTAAGC TTACTTCTCCATGACAGAGAAGTAAACTGCTCGACAAGTGAAATGGTACCAAGCCAACCT GTAATGGGTCAAACCTGCGGTCAGTTTATGAAACCCTTTATTGATGAATTTGGTGGGAAA CTGCACATCAATAACACATACACCGTCTGCGCCTACTGCATGTACACTGTTGGGGATGAC TTCCTTGCTCAAGAAAATATGAGTTATCATCACAGATGGAGAAATTTTGGTTTTGAATGG GTTTTCGTTTGCTTTAACATTGCCGCCATGTTTGTGGGCTTCTACCTAACCTACATCAAA AAAATTTGGCCTTCTGTGATTGATGGTATAAAGAAGTGTATCCCATCAATGAGGCGGTCC AAAACATCTCATAATCCAAACGAACAAAGCGTATAA
Protein Properties
Pfam Domain Function
Protein Residues1411
Protein Molecular Weight160536.0
Protein Theoretical pI6.86
Signalling Regions
  • None
Transmembrane Regions
  • 389-409
  • 419-439
  • 472-492
  • 495-515
  • 525-545
  • 637-657
  • 1091-1111
  • 1118-1138
  • 1176-1196
  • 1205-1225
  • 1231-1251
  • 1356-1376
Protein Sequence>ATP-dependent permease PDR11 MSLSKYFNPIPDASVTFDGATVQLEESLGAVQNDEESASEFKNVGHLEISDITFRANEGE VVLVLGNPTSALFKGLFHGHKHLKYSPEGSIRFKDNEYKQFASKCPHQIIYNNEQDIHFP YLTVEQTIDFALSCKFHIPKQERIEMRDELLKEFGLSHVKKTYVGNDYVRGVSGGERKRI SIIETFIANGSVYLWDNSTKGLDSATALEFLSITQKMAKATRSVNFVKISQASDKIVSKF DKILMLGDSFQVFYGTMEECLTHFHDTLQIKKNPNDCIIEYLTSILNFKFKETSNSIVGL DTPSVVSEENQALNINNETDLHTLWIQSPYYKHWKAITSKTVQECTRKDVNPDDISPIFS IPLKTQLKTCTVRAFERIIGDRNYLISQFVSVVVQSLVIGSLFYNIPLTTIGSFSRGSLT FFSILFFTFLSLADMPASFQRQPVVRKHVQLHFYYNWVETLATNFFDCCSKFILVVIFTI ILYFLAHLQYNAARFFIFLLFLSVYNFCMVSLFALTALIAPTLSMANLLAGILLLAIAMY ASYVIYMKDMHPWFIWIAYLNPAMFAMEAILSNELFNLKLDCHESIIPRGEYYDNISFSH KACAWQGATLGNDYVRGRDYLKSGLKYTYHHVWRNFGIIIGFLCFFLFCSLLAAEYITPL FTRENLLRWNNYLKRYCPFLNSQKKNNKSAITNNDGVCTPKTPIANFSTSSSSVPSVSHQ YDTDYNIKHPDETVNNHTKESVAMETQKHVISWKNINYTIGDKKLINDASGYISSGLTAL MGESGAGKTTLLNVLSQRTESGVVTGELLIDGQPLTNIDAFRRSIGFVQQQDVHLELLTV RESLEISCVLRGDGDRDYLGVVSNLLRLPSEKLVADLSPTQRKLLSIGVELVTKPSLLLF LDEPTSGLDAEAALTIVQFLKKLSMQGQAILCTIHQPSKSVISYFDNIYLLKRGGECVYF GSLPNACDYFVAHDRRLTFDREMDNPADFVIDVVGSGSTNIPMDDAEKPTSSKIDEPVSY HKQSDSINWAELWQSSPEKVRVADDLLLLEEEARKSGVDFTTSVWSPPSYMEQIKLITKR QYICTKRDMTYVFAKYALNAGAGLFIGFSFWRTKHNINGLQDAIFLCFMMLCVSSPLINQ VQDKALQSKEVYIAREARSNTYHWTVLLIAQTIVELPLAISSSTLFFLCCYFCCGFETSA RVAGVFYLNYILFSMYYLSFGLWLLYSAPDLQTAAVFVAFLYSFTASFCGVMQPYSLFPR FWTFMYRVSPYTYFIETFVSLLLHDREVNCSTSEMVPSQPVMGQTCGQFMKPFIDEFGGK LHINNTYTVCAYCMYTVGDDFLAQENMSYHHRWRNFGFEWVFVCFNIAAMFVGFYLTYIK KIWPSVIDGIKKCIPSMRRSKTSHNPNEQSV
References
External Links
ResourceLink
Saccharomyces Genome Database PDR11
Uniprot IDP40550
Uniprot NamePDR11_YEAST
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Decottignies, A., Lambert, L., Catty, P., Degand, H., Epping, E. A., Moye-Rowley, W. S., Balzi, E., Goffeau, A. (1995). "Identification and characterization of SNQ2, a new multidrug ATP binding cassette transporter of the yeast plasma membrane." J Biol Chem 270:18150-18157.7629127
  • Wilcox, L. J., Balderes, D. A., Wharton, B., Tinkelenberg, A. H., Rao, G., Sturley, S. L. (2002). "Transcriptional profiling identifies two members of the ATP-binding cassette transporter superfamily required for sterol uptake in yeast." J Biol Chem 277:32466-32472.12077145
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258