You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProbable phospholipid-transporting ATPase NEO1
SynonymsNot Available
Gene NameNEO1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of phospholipids (Potential). Leads to neomycin-resistance when overexpressed. Required for traffic between late Golgi and early endosomes
Cellular LocationEndosome membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
membrane
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
transporter activity
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
transmembrane transporter activity
binding
nucleoside binding
purine nucleoside binding
hydrolase activity
substrate-specific transporter activity
adenyl nucleotide binding
substrate-specific transmembrane transporter activity
lipid transporter activity
adenyl ribonucleotide binding
ion transmembrane transporter activity
phospholipid transporter activity
ATP binding
magnesium ion binding
phospholipid-translocating ATPase activity
ion binding
ATPase activity, coupled to transmembrane movement of ions
catalytic activity
cation binding
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
metal ion binding
hydrolase activity, acting on acid anhydrides
Process
purine nucleotide biosynthetic process
purine nucleoside triphosphate biosynthetic process
establishment of localization
purine ribonucleoside triphosphate biosynthetic process
transport
ATP biosynthetic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
lipid transport
nucleoside phosphate metabolic process
metabolic process
phospholipid transport
nucleotide metabolic process
purine nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL048W
Gene Sequence>3456 bp ATGCCTAACCCTCCTTCATTTAAGTCACATAAGCAGAATTTATTCAACTCCAACAATAAT CAACACGCAAACAGTGTAGATTCTTTTGACTTACATCTCGACGATTCATTTGACGCTGCT TTAGACAGTTTACAAATTAATAATAACCCAGAACCACTTAGTAAGCATAACACTGTTGGA GATAGGGAAAGTTTTGAAATGAGAACAGTAGATGATTTAGACAATTTTTCTAACCATTCT TCGGATTCGCATCGTAAGTCTTCAAACACAGATACCCATCCTTTGATGTATGATAATCGC CTCTCGCAGGATGATAATTTCAAATTTACTAATATTGCTTCGTCACCACCGTCGTCTTCA AACAATATTTTTTCAAAAGCCCTCTCATATTTAAAAGTATCTAACACAAAAAACTGGTCC AAGTTTGGTTCACCCATAGAACTCAGTGATCAACACATCGAAAGAGAAATACATCCAGAC ACGACTCCTGTGTACGATAGGAATAGATACGTTTCGAATGAACTATCTAATGCCAAATAT AATGCCGTTACTTTTGTGCCAACCCTATTATATGAACAGTTCAAATTCTTTTACAATTTA TACTTTTTAGTAGTTGCATTATCGCAGGCCGTTCCTGCACTAAGAATAGGGTATTTATCA TCGTATATTGTACCTTTAGCATTTGTGCTGACAGTAACCATGGCAAAGGAAGCTATAGAT GATATTCAGAGAAGGAGACGTGATAGAGAGTCAAACAATGAACTGTATCATGTAATAACG AGAAATCGTTCCATACCAAGCAAAGACTTAAAAGTTGGAGATCTCATAAAAGTCCATAAA GGTGATCGTATTCCCGCTGATTTGGTTCTTTTACAATCAAGTGAACCATCAGGCGAGTCA TTTATCAAAACTGACCAACTAGATGGGGAGACTGACTGGAAACTACGTGTTGCCTGTCCC TTGACCCAAAATCTATCTGAAAATGACTTAATTAACAGAATTAGTATAACAGCCTCTGCT CCTGAGAAATCTATTCATAAATTTTTAGGTAAAGTTACCTATAAGGATTCCACTTCAAAC CCTTTGTCTGTAGATAATACTCTATGGGCGAATACTGTTCTAGCTTCCAGTGGATTTTGT ATTGCTTGTGTCGTCTACACTGGCAGAGATACTAGGCAAGCTATGAATACAACTACAGCT AAGGTTAAAACTGGCTTATTAGAGCTAGAAATTAACAGTATTTCCAAGATTCTTTGTGCA TGTGTTTTTGCCCTGTCAATTCTTTTAGTTGCATTTGCCGGTTTCCACAATGACGACTGG TACATTGACATTTTGAGGTATCTGATATTGTTTTCTACCATCATCCCTGTCTCTTTAAGA GTTAATTTAGATTTAGCCAAAAGTGTTTATGCACATCAGATCGAACACGATAAAACCATT CCTGAAACAATTGTTAGAACGAGTACAATTCCAGAGGATTTAGGCCGTATTGAATACCTT CTAAGCGACAAAACAGGGACGCTTACTCAGAATGATATGCAATTGAAGAAAATACACTTG GGTACTGTATCATACACGTCGGAAACATTAGACATTGTATCCGACTATGTACAATCTCTG GTGAGCTCTAAAAATGACTCTTTGAACAATTCTAAAGTTGCCTTATCAACAACAAGAAAG GATATGTCTTTTCGTGTACGTGATATGATTTTAACTCTAGCAATTTGCCATAACGTTACT CCCACTTTTGAGGATGACGAACTTACATATCAAGCGGCATCACCTGATGAAATTGCTATT GTTAAATTTACCGAGTCGGTTGGCTTATCTCTTTTCAAAAGAGATCGCCATTCAATTTCT TTATTACACGAACATTCTGGTAAGACTTTAAATTACGAAATTTTACAAGTATTCCCATTT AATTCTGATTCTAAGCGTATGGGTATCATTGTTCGTGATGAGCAATTGGATGAATATTGG TTTATGCAAAAAGGGGCCGATACTGTCATGTCAAAAATTGTGGAAAGCAATGATTGGCTA GAGGAAGAAACAGGTAATATGGCTCGTGAAGGTCTACGTACTTTGGTTATCGGTCGTAAA AAATTAAACAAGAAAATTTACGAGCAATTTCAAAAAGAATACAACGATGCCTCTTTGTCA ATGCTAAATCGTGATCAACAGATGAGTCAAGTTATCACCAAGTATTTAGAGCATGATCTT GAATTATTGGGTCTAACTGGTGTAGAAGATAAGTTACAGAAGGATGTGAAGTCCTCTATC GAGTTATTAAGAAACGCAGGTATCAAGATTTGGATGCTGACAGGTGATAAAGTTGAAACT GCTCGTTGTGTTTCCATAAGTGCAAAATTAATATCTCGTGGCCAATATGTTCATACGATA ACAAAAGTCACAAGACCGGAAGGTGCATTCAATCAGCTGGAGTATCTAAAAATCAATAGA AATGCTTGTCTTTTAATAGATGGTGAATCCCTGGGAATGTTTTTGAAACATTACGAACAG GAATTTTTTGATGTCGTGGTTCATTTACCCACTGTTATTGCTTGCCGTTGTACACCTCAA CAGAAGGCAGACGTTGCTTTGGTAATTCGTAAAATGACGGGCAAAAGGGTATGCTGTATT GGTGATGGAGGTAACGATGTTAGTATGATTCAATGTGCAGATGTTGGCGTAGGGATTGTG GGTAAAGAAGGTAAACAAGCTTCTTTAGCTGCTGATTTTTCTATAACGCAATTTTGTCAC CTCACCGAATTACTATTATGGCATGGTAGGAACTCTTACAAAAGATCTGCTAAATTGGCT CAATTTGTCATGCATAGAGGTTTAATCATTGCAATTTGCCAAGCGGTATATTCCATCTGT TCGTTGTTCGAACCTATTGCTCTTTATCAAGGTTGGTTAATGGTCGGTTATGCTACCTGC TATACAATGGCTCCAGTCTTTTCATTAACTCTTGATCACGATATCGAAGAGTCATTGACT AAAATATACCCAGAATTGTACAAAGAATTGACTGAAGGTAAGAGCTTATCATATAAGACG TTCTTTGTTTGGGTTCTATTATCGCTATTCCAAGGTTCTGTAATTCAATTATTTTCTCAG GCCTTTACGAGTTTATTAGATACTGATTTCACAAGGATGGTTGCTATCAGCTTCACTGCT TTGGTTGTAAATGAATTAATAATGGTTGCCTTAGAAATCTACACATGGAATAAAACAATG CTCGTCACTGAAATTGCTACTTTACTATTTTACATTGTATCGGTTCCATTTCTTGGCGAT TATTTTGATTTAGGTTATATGACTACCGTAAATTACTATGCTGGACTTTTAGTTATATTA CTCATCTCGATCTTTCCTGTCTGGACGGCAAAGGCAATTTATAGAAGGCTACATCCTCCA AGTTATGCAAAAGTGCAAGAGTTTGCCACTCCATAA
Protein Properties
Pfam Domain Function
Protein Residues1151
Protein Molecular Weight130217.0
Protein Theoretical pI6.43
Signalling Regions
  • None
Transmembrane Regions
  • 185-205
  • 210-230
  • 368-388
  • 417-437
  • 439-459
  • 948-968
  • 971-991
  • 1021-1041
  • 1053-1073
  • 1079-1099
  • 1110-1130
Protein Sequence>Probable phospholipid-transporting ATPase NEO1 MPNPPSFKSHKQNLFNSNNNQHANSVDSFDLHLDDSFDAALDSLQINNNPEPLSKHNTVG DRESFEMRTVDDLDNFSNHSSDSHRKSSNTDTHPLMYDNRLSQDDNFKFTNIASSPPSSS NNIFSKALSYLKVSNTKNWSKFGSPIELSDQHIEREIHPDTTPVYDRNRYVSNELSNAKY NAVTFVPTLLYEQFKFFYNLYFLVVALSQAVPALRIGYLSSYIVPLAFVLTVTMAKEAID DIQRRRRDRESNNELYHVITRNRSIPSKDLKVGDLIKVHKGDRIPADLVLLQSSEPSGES FIKTDQLDGETDWKLRVACPLTQNLSENDLINRISITASAPEKSIHKFLGKVTYKDSTSN PLSVDNTLWANTVLASSGFCIACVVYTGRDTRQAMNTTTAKVKTGLLELEINSISKILCA CVFALSILLVAFAGFHNDDWYIDILRYLILFSTIIPVSLRVNLDLAKSVYAHQIEHDKTI PETIVRTSTIPEDLGRIEYLLSDKTGTLTQNDMQLKKIHLGTVSYTSETLDIVSDYVQSL VSSKNDSLNNSKVALSTTRKDMSFRVRDMILTLAICHNVTPTFEDDELTYQAASPDEIAI VKFTESVGLSLFKRDRHSISLLHEHSGKTLNYEILQVFPFNSDSKRMGIIVRDEQLDEYW FMQKGADTVMSKIVESNDWLEEETGNMAREGLRTLVIGRKKLNKKIYEQFQKEYNDASLS MLNRDQQMSQVITKYLEHDLELLGLTGVEDKLQKDVKSSIELLRNAGIKIWMLTGDKVET ARCVSISAKLISRGQYVHTITKVTRPEGAFNQLEYLKINRNACLLIDGESLGMFLKHYEQ EFFDVVVHLPTVIACRCTPQQKADVALVIRKMTGKRVCCIGDGGNDVSMIQCADVGVGIV GKEGKQASLAADFSITQFCHLTELLLWHGRNSYKRSAKLAQFVMHRGLIIAICQAVYSIC SLFEPIALYQGWLMVGYATCYTMAPVFSLTLDHDIEESLTKIYPELYKELTEGKSLSYKT FFVWVLLSLFQGSVIQLFSQAFTSLLDTDFTRMVAISFTALVVNELIMVALEIYTWNKTM LVTEIATLLFYIVSVPFLGDYFDLGYMTTVNYYAGLLVILLISIFPVWTAKAIYRRLHPP SYAKVQEFATP
References
External Links
ResourceLink
Saccharomyces Genome Database NEO1
Uniprot IDP40527
Uniprot NameATC7_YEAST
GenBank Gene IDZ38060
Genebank Protein ID557820
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Wicky, S., Schwarz, H., Singer-Kruger, B. (2004). "Molecular interactions of yeast Neo1p, an essential member of the Drs2 family of aminophospholipid translocases, and its role in membrane trafficking within the endomembrane system." Mol Cell Biol 24:7402-7418.15314152
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956