Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized protein YIL083C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionCoenzyme transport and metabolism
Specific FunctionNot Available
Cellular LocationNot Available
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
D-4'-Phosphopantothenate + Cytidine triphosphate + L-CysteineCytidine monophosphate + Pyrophosphate + hydron + 4-Phosphopantothenoylcysteine
D-4'-Phosphopantothenate + Cytidine triphosphate + L-CysteineCytidine monophosphate + Pyrophosphate + hydron + 4-Phosphopantothenoylcysteine
4-Phosphopantothenoylcysteine + hydronCarbon dioxide + 4'-phosphopantetheine
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB00219PyrophosphateShow
YMDB00272D-4'-PhosphopantothenateShow
YMDB00279Cytidine triphosphateShow
YMDB004004-PhosphopantothenoylcysteineShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
YMDB162644'-phosphopantetheineShow
GO ClassificationNot Available
Gene Properties
Chromosome LocationNot Available
LocusYIL083C
Gene Sequence>1098 bp ATGCCACCTCTACCCGTGCTCAACAGACCTCAAATTCATACGTCTGTTACTGAAATAAGT CATGCAATTGATCGTACAATCAAGGAAGAGCTCTTTCCCGTTGCCTACACTACTGAAGAA GAGCAATATTTCAAAACTAACCCTAAACCTGCCTATATCGATGAATTGATTAAGGACGCT AAAGAGTTTATTGATTTGCAGTATTCCCTGAAAAGGAACAAAATAGTTCTTATCACCTCT GGTGGTACTACTGTTCCATTGGAAAACAATACAGTACGTTTTATCGATAATTTTTCTGCA GGTACTCGTGGTGCATCGAGTGCTGAACAGTTCTTAGCGAACGGATATAGTGTTATTTTC TTACATAGGGAATTCTCATTAACTCCGTATAATAGGTCCTTCTCCCATAGCATTAATACT TTATTCTTGGACTACATTGATTCTGAAGGTAAAATCAAACCTGAATTTGCTGAGAATGTT TTGAAGAACAAAAAGCTTTATGACAAGTATATGGAGAAAGAGGAGAAACTACTTTTACTA CCATTCACCACGGTCAACCAATACTTATGGTCACTGAAAAGTATAGCCAAGCTATTGAAT AATAGTGGTTGCTTGTTTTATTTAGCTGCTGCTGTCAGTGATTTTTTTGTTCCATATTCA AGACTACCTCAGCACAAGATTCAATCAGGAGACAACGGTAAGATGGGAGCAAATAATGAC ACTGAAGGTACAACTAGGACTACGCCTGATGGTAAACTGATTGTGAATCTTGACCCTGTC CCTAAGTTTTTGAGAAGATTAGTGGAATCATGGGCCACTCAAGCGATGATCGTTTCGTTC AAATTAGAAACTGATGAATCCATGCTGCTTTACAAATGTACACAAGCCCTGGATAGATAC AACCATCAACTGGTTATCGGAAACCTTTTACAGACAAGAAACAAACAGGTCATTTTCGTA TCCCCTGAAAACAGAAAGGGAGATTGGGTACGTTTGGATGAAAAACACCATATCATTGAA GAGATGATAATCCCAGAAGTCATCGCACGCCATGACAAATGGGTGGCGCATTCGAAAACT AAGCTAGCTACGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues365
Protein Molecular Weight41892.69922
Protein Theoretical pI8.55
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uncharacterized protein YIL083C MPPLPVLNRPQIHTSVTEISHAIDRTIKEELFPVAYTTEEEQYFKTNPKPAYIDELIKDA KEFIDLQYSLKRNKIVLITSGGTTVPLENNTVRFIDNFSAGTRGASSAEQFLANGYSVIF LHREFSLTPYNRSFSHSINTLFLDYIDSEGKIKPEFAENVLKNKKLYDKYMEKEEKLLLL PFTTVNQYLWSLKSIAKLLNNSGCLFYLAAAVSDFFVPYSRLPQHKIQSGDNGKMGANND TEGTTRTTPDGKLIVNLDPVPKFLRRLVESWATQAMIVSFKLETDESMLLYKCTQALDRY NHQLVIGNLLQTRNKQVIFVSPENRKGDWVRLDEKHHIIEEMIIPEVIARHDKWVAHSKT KLATK
References
External Links
ResourceLink
Saccharomyces Genome Database YIL083C
Uniprot IDP40506
Uniprot NameYII3_YEAST
GenBank Gene IDZ46728
Genebank Protein ID577131
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106