You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMitochondrial FAD carrier protein FLX1
SynonymsNot Available
Gene NameFLX1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in binding
Specific FunctionTransport of FAD from the cytosol to the mitochondrial matrix
Cellular LocationMitochondrion inner membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00296FADShow
YMDB00597FADH2Show
GO Classification
Component
organelle membrane
organelle inner membrane
mitochondrial inner membrane
cell part
membrane
Function
binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 9
LocusYIL134W
Gene Sequence>936 bp ATGGTCGATCACCAGTGGACGCCACTGCAGAAGGAGGTTATCTCAGGTCTGTCCGCGGGA TCCGTCACCACATTGGTAGTGCATCCATTAGATTTACTGAAGGTTCGTTTGCAATTATCC GCTACAAGCGCACAAAAGGCCCATTACGGCCCATTTATGGTAATCAAAGAGATTATACGT TCGTCGGCGAATAGTGGACGTAGTGTTACGAACGAACTGTATCGCGGATTAAGCATAAAT TTGTTTGGAAATGCCATTGCATGGGGAGTTTATTTCGGTTTATATGGTGTCACGAAAGAA TTGATATACAAGTCAGTGGCAAAGCCAGGGGAAACACAGCTTAAAGGTGTTGGGAACGAC CACAAAATGAATTCGCTTATTTATTTGTCTGCCGGTGCTTCCAGTGGGTTGATGACAGCT ATCCTAACAAACCCTATCTGGGTTATAAAGACCAGGATAATGTCTACAAGTAAAGGCGCC CAAGGAGCGTACACTTCTATGTACAACGGTGTCCAACAACTGTTACGAACTGATGGCTTC CAGGGCCTATGGAAGGGCCTTGTACCCGCACTGTTTGGTGTTTCGCAAGGTGCCTTATAT TTTGCAGTTTACGATACCTTAAAGCAAAGAAAATTGCGACGGAAGAGGGAAAATGGGCTT GACATCCATTTAACAAATCTTGAAACCATTGAAATCACATCGTTGGGAAAAATGGTCTCC GTCACTTTGGTTTACCCTTTTCAATTATTGAAATCAAACTTACAAAGTTTCAGGGCCAAT GAGCAAAAATTTAGGCTCTTTCCTTTGATAAAATTAATCATTGCTAATGATGGTTTTGTT GGACTTTATAAGGGCCTATCTGCAAACTTAGTACGGGCCATTCCATCCACTTGCATTACC TTTTGTGTATACGAGAACCTTAAGCATAGGCTTTAG
Protein Properties
Pfam Domain Function
Protein Residues311
Protein Molecular Weight34408.89844
Protein Theoretical pI10.42
Signalling Regions
  • None
Transmembrane Regions
  • 13-33
  • 77-97
  • 129-149
  • 183-203
  • 230-250
  • 266-286
Protein Sequence>Mitochondrial FAD carrier protein FLX1 MVDHQWTPLQKEVISGLSAGSVTTLVVHPLDLLKVRLQLSATSAQKAHYGPFMVIKEIIR SSANSGRSVTNELYRGLSINLFGNAIAWGVYFGLYGVTKELIYKSVAKPGETQLKGVGND HKMNSLIYLSAGASSGLMTAILTNPIWVIKTRIMSTSKGAQGAYTSMYNGVQQLLRTDGF QGLWKGLVPALFGVSQGALYFAVYDTLKQRKLRRKRENGLDIHLTNLETIEITSLGKMVS VTLVYPFQLLKSNLQSFRANEQKFRLFPLIKLIIANDGFVGLYKGLSANLVRAIPSTCIT FCVYENLKHRL
References
External Links
ResourceLink
Saccharomyces Genome Database FLX1
Uniprot IDP40464
Uniprot NameFLX1_YEAST
GenBank Gene IDAY692757
Genebank Protein ID51012965
General Reference
  • Tzagoloff, A., Jang, J., Glerum, D. M., Wu, M. (1996). "FLX1 codes for a carrier protein involved in maintaining a proper balance of flavin nucleotides in yeast mitochondria." J Biol Chem 271:7392-7397.8631763
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287