Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePantoate--beta-alanine ligase
Synonyms
  • Pantoate-activating enzyme
  • Pantothenate synthetase
Gene NamePAN6
Enzyme Class
Biological Properties
General FunctionInvolved in pantoate-beta-alanine ligase activity
Specific FunctionRequired for pantothenic acid biosynthesis
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pantothenate and CoA biosynthesisPW002463 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pantothenate and CoA biosynthesisec00770 Map00770
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Beta-Alanine + (R)-Pantoate + Adenosine triphosphatePantothenic acid + Adenosine monophosphate + Pyrophosphate + hydron
Beta-Alanine + Adenosine triphosphate + (R)-PantoateAdenosine monophosphate + Pyrophosphate + hydron + Pantothenic acid
KEGG Reactions
Adenosine triphosphate + (R)-Pantoic acid + Beta-AlanineAdenosine monophosphate + Pyrophosphate + (R)-Pantothenic acid + hydron
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00195Beta-AlanineShow
YMDB00203(R)-Pantothenic acidShow
YMDB00219PyrophosphateShow
YMDB00376(R)-Pantoic acidShow
YMDB00862hydronShow
YMDB01012(R)-PantoateShow
YMDB01522Pantothenic acidShow
GO Classification
Component
Not Available
Function
ligase activity
ligase activity, forming carbon-nitrogen bonds
acid-amino acid ligase activity
catalytic activity
pantoate-beta-alanine ligase activity
Process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pantothenate biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL145C
Gene Sequence>YIL145C PAN6 SGDID:S000001407, Chr IX from 77283-76354, reverse complement, Verified ORF, "Pantothenate synthase, also known as pantoate-beta-alanine ligase, required for pantothenic acid biosynthesis, deletion causes pantothenic acid auxotrophy, homologo ATGAAAATCTTCCATACTGTCGAAGAAGTTGTTCAATGGAGAACACAGGAGCTGAGGGAA ACTAGATTTAGAGAAACTATTGGGTTCGTTCCCACAATGGGTTGCCTGCATTCGGGTCAC GCTAGTTTGATCTCGCAGTCTGTGAAGGAAAACACCTATACTGTGGTCAGTATATTTGTA AATCCCTCCCAGTTTGCGCCAACGGAAGATCTAGATAACTATCCTCGAACTTTGCCAGAC GACATCAAATTGCTTGAGTCGTTGAAGGTGGATGTTCTATTTGCTCCTAATGCACACGTG ATGTATCCACAGGGAATTCCGCTCGACATAGAAGAGCAGAAAGGCCCTTTTGTTAGTGTT CTTGGATTGAGTGAAAAATTAGAGGGGAAGACGAGACCTAACTTCTTTAGGGGCGTGGCA ACTGTCGTGACTAAACTATTCAATATCGTTATGGCGGATGTGGCTTATTTTGGGCAGAAG GACATTCAACAGTTCATTGTTTTACAGTGTATGGTGGACGAACTGTTTGTTAATACAAGG CTACAAATGATGCCTATTGTAAGAAACAATAATGGACTGGCTCTGAGTAGTAGAAACAAA TATCTTTGTCCAGAGTCTTTAAAGATCTCTGAAAACCTTTACCGCGGGCTGAAAGCTGCG GAAAATGCTATTAGGAGACTAGCACCAGGGGGACGTCTCTCCAGATCAGAAATCATCGAT ACTGTGACTCAAATATGGGCACCCTACGTTGATTCCCACGATTTCAAAATCGACTATGTT TCCTTAGCAGATTTTAAGACTCTTGATGAACTCTCCGATGTTGAAAACACCAGCGAACAG CAGCCAATAGTCATTAGTTGTGCTGTATACGTGACTGACCGCGAAAAACCCGATACGGTC GTCAGACTAATAGATAACATCGTTATTTAA
Protein Properties
Pfam Domain Function
Protein Residues309
Protein Molecular Weight35031.89844
Protein Theoretical pI5.08
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pantoate--beta-alanine ligase MKIFHTVEEVVQWRTQELRETRFRETIGFVPTMGCLHSGHASLISQSVKENTYTVVSIFV NPSQFAPTEDLDNYPRTLPDDIKLLESLKVDVLFAPNAHVMYPQGIPLDIEEQKGPFVSV LGLSEKLEGKTRPNFFRGVATVVTKLFNIVMADVAYFGQKDIQQFIVLQCMVDELFVNTR LQMMPIVRNNNGLALSSRNKYLCPESLKISENLYRGLKAAENAIRRLAPGGRLSRSEIID TVTQIWAPYVDSHDFKIDYVSLADFKTLDELSDVENTSEQQPIVISCAVYVTDREKPDTV VRLIDNIVI
References
External Links
ResourceLink
Saccharomyces Genome Database PAN6
Uniprot IDP40459
Uniprot NamePANC_YEAST
General Reference
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870
  • White, W. H., Gunyuzlu, P. L., Toyn, J. H. (2001). "Saccharomyces cerevisiae is capable of de Novo pantothenic acid biosynthesis involving a novel pathway of beta-alanine production from spermine." J Biol Chem 276:10794-10800.11154694
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106